Anti LYPD3 pAb (ATL-HPA041797 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041797-25

Protein Description: LY6/PLAUR domain containing 3
Gene Name: LYPD3
Alternative Gene Name: C4.4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057454: 88%, ENSRNOG00000019999: 89%
Entrez Gene ID: 27076
Uniprot ID: O95274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGN
• Gene Sequence: DGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGN
• Gene ID - Mouse: ENSMUSG00000057454
• Gene ID - Rat: ENSRNOG00000019999
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LYPD3 pAb (ATL-HPA041797 w/enhanced validation) – 1 Found

Cocce, Kimberly J; Jasper, Jeff S; Desautels, Taylor K; Everett, Logan; Wardell, Suzanne; Westerling, Thomas; Baldi, Robert; Wright, Tricia M; Tavares, Kendall; Yllanes, Alex; Bae, Yeeun; Blitzer, Jeremy T; Logsdon, Craig; Rakiec, Daniel P; Ruddy, David A; Jiang, Tiancong; Broadwater, Gloria; Hyslop, Terry; Hall, Allison; Laine, Muriel; Phung, Linda; Greene, Geoffrey L; Martin, Lesley-Ann; Pancholi, Sunil; Dowsett, Mitch; Detre, Simone; Marks, Jeffrey R; Crawford, Gregory E; Brown, Myles; Norris, John D; Chang, Ching-Yi; McDonnell, Donald P. The Lineage Determining Factor GRHL2 Collaborates with FOXA1 to Establish a Targetable Pathway in Endocrine Therapy-Resistant Breast Cancer. Cell Reports. 2019;29(4):889-903.e10.