Anti KLHDC3 pAb (ATL-HPA030132)

Atlas Antibodies

Catalog No.: ATL-HPA030132-25

Protein Description: kelch domain containing 3
Gene Name: KLHDC3
Alternative Gene Name: dJ20C7.3, hPeas, PEAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063576: 97%, ENSRNOG00000017495: 97%
Entrez Gene ID: 116138
Uniprot ID: Q9BQ90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSF
• Gene Sequence: FHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSF
• Gene ID - Mouse: ENSMUSG00000063576
• Gene ID - Rat: ENSRNOG00000017495
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.