Anti HUWE1 pAb (ATL-HPA002548)

Atlas Antibodies

Catalog No.: ATL-HPA002548-25

Protein Description: HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase
Gene Name: HUWE1
Alternative Gene Name: Ib772, KIAA0312, UREB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025261: 99%, ENSRNOG00000061262: 86%
Entrez Gene ID: 10075
Uniprot ID: Q7Z6Z7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLE
• Gene Sequence: SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLE
• Gene ID - Mouse: ENSMUSG00000025261
• Gene ID - Rat: ENSRNOG00000061262
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HUWE1 pAb (ATL-HPA002548) – 2 Found

Lee, Hong-Jen; Li, Chien-Feng; Ruan, Diane; He, Jiabei; Montal, Emily D; Lorenz, Sonja; Girnun, Geoffrey D; Chan, Chia-Hsin. Non-proteolytic ubiquitination of Hexokinase 2 by HectH9 controls tumor metabolism and cancer stem cell expansion. Nature Communications. 2019;10(1):2625. 

Crawford, Lisa J; Campbell, David C; Morgan, Jonathan J; Lawson, Michelle A; Down, Jennifer M; Chauhan, Dharminder; McAvera, Roisin M; Morris, Treen C; Hamilton, Claudia; Krishnan, Aswini; Rajalingam, Krishnaraj; Chantry, Andrew D; Irvine, Alexandra E. The E3 ligase HUWE1 inhibition as a therapeutic strategy to target MYC in multiple myeloma. Oncogene. 2020;39(27):5001-5014.