Anti HPGD pAb (ATL-HPA004919 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004919-25

Protein Description: hydroxyprostaglandin dehydrogenase 15-(NAD)
Gene Name: HPGD
Alternative Gene Name: SDR36C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031613: 97%, ENSRNOG00000010610: 95%
Entrez Gene ID: 3248
Uniprot ID: P15428
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV
• Gene Sequence: VDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV
• Gene ID - Mouse: ENSMUSG00000031613
• Gene ID - Rat: ENSRNOG00000010610
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HPGD pAb (ATL-HPA004919 w/enhanced validation) – 3 Found

Gibbs, David Corley; Fedirko, Veronika; Baron, John A; Barry, Elizabeth L; Flanders, W Dana; McCullough, Marjorie L; Yacoub, Rami; Raavi, Tapasya; Rutherford, Robin E; Seabrook, March E; Bostick, Roberd M. Inflammation Modulation by Vitamin D and Calcium in the Morphologically Normal Colorectal Mucosa of Patients with Colorectal Adenoma in a Clinical Trial. Cancer Prevention Research (Philadelphia, Pa.). 2021;14(1):65-76. 

Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. 

Massoner, Petra; Kugler, Karl G; Unterberger, Karin; Kuner, Ruprecht; Mueller, Laurin A J; Fälth, Maria; Schäfer, Georg; Seifarth, Christof; Ecker, Simone; Verdorfer, Irmgard; Graber, Armin; Sültmann, Holger; Klocker, Helmut. Characterization of transcriptional changes in ERG rearrangement-positive prostate cancer identifies the regulation of metabolic sensors such as neuropeptide Y. Plos One. 8(2):e55207.