Anti FXYD6 pAb (ATL-HPA042284)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042284-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FXYD6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066705: 93%, ENSRNOG00000016412: 93%
Entrez Gene ID: 53826
Uniprot ID: Q9H0Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CKCSFNQKPRAPGDEEAQVENLITANATEP |
Gene Sequence | CKCSFNQKPRAPGDEEAQVENLITANATEP |
Gene ID - Mouse | ENSMUSG00000066705 |
Gene ID - Rat | ENSRNOG00000016412 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FXYD6 pAb (ATL-HPA042284) | |
Datasheet | Anti FXYD6 pAb (ATL-HPA042284) Datasheet (External Link) |
Vendor Page | Anti FXYD6 pAb (ATL-HPA042284) at Atlas Antibodies |
Documents & Links for Anti FXYD6 pAb (ATL-HPA042284) | |
Datasheet | Anti FXYD6 pAb (ATL-HPA042284) Datasheet (External Link) |
Vendor Page | Anti FXYD6 pAb (ATL-HPA042284) |