Anti EPCAM pAb (ATL-HPA026761 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA026761-25

• 
• 

Protein Description: epithelial cell adhesion molecule
Gene Name: EPCAM
Alternative Gene Name: 17-1A, 323/A3, CD326, CO-17A, EGP-2, EGP34, EGP40, Ep-CAM, ESA, GA733-2, HEA125, KS1/4, KSA, Ly74, M4S1, MH99, MIC18, MK-1, MOC31, TACST-1, TACSTD1, TROP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045394: 83%, ENSRNOG00000015667: 82%
Entrez Gene ID: 4072
Uniprot ID: P16422
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY
• Gene Sequence: LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY
• Gene ID - Mouse: ENSMUSG00000045394
• Gene ID - Rat: ENSRNOG00000015667
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EPCAM pAb (ATL-HPA026761 w/enhanced validation) – 6 Found

Mohtar, M Aiman; Hernychova, Lenka; O'Neill, J Robert; Lawrence, Melanie L; Murray, Euan; Vojtesek, Borek; Hupp, Ted R. The Sequence-specific Peptide-binding Activity of the Protein Sulfide Isomerase AGR2 Directs Its Stable Binding to the Oncogenic Receptor EpCAM. Molecular & Cellular Proteomics : Mcp. 2018;17(4):737-763. 

Herheliuk, Tetiana; Perepelytsina, Olena; Ugnivenko, Andrij; Ostapchenko, Lyudmila; Sydorenko, Mikhailo. Response of breast cancer cells to IFNα-2b in 2D and 3D cell cultures. Turkish Journal Of Biology = Turk Biyoloji Dergisi. 43(1):13-20. 

Yu, Qianhui; Kilik, Umut; Holloway, Emily M; Tsai, Yu-Hwai; Harmel, Christoph; Wu, Angeline; Wu, Joshua H; Czerwinski, Michael; Childs, Charlie J; He, Zhisong; Capeling, Meghan M; Huang, Sha; Glass, Ian A; Higgins, Peter D R; Treutlein, Barbara; Spence, Jason R; Camp, J Gray. Charting human development using a multi-endodermal organ atlas and organoid models. Cell. 2021;184(12):3281-3298.e22. 

Decuypere, Jean-Paul; Van Giel, Dorien; Janssens, Peter; Dong, Ke; Somlo, Stefan; Cai, Yiqiang; Mekahli, Djalila; Vennekens, Rudi. Interdependent Regulation of Polycystin Expression Influences Starvation-Induced Autophagy and Cell Death. International Journal Of Molecular Sciences. 2021;22(24) 

Sander, Veronika; Przepiorski, Aneta; Crunk, Amanda E; Hukriede, Neil A; Holm, Teresa M; Davidson, Alan J. Protocol for Large-Scale Production of Kidney Organoids from Human Pluripotent Stem Cells. Star Protocols. 2020;1(3):100150. 

Ruano, Anna Paula Carreta; Gadelha Guimarães, Andrea Paiva; Braun, Alexcia C; Flores, Bianca C T C P; Tariki, Milena Shizue; Abdallah, Emne A; Torres, Jacqueline Aparecida; Nunes, Diana Noronha; Tirapelli, Bruna; de Lima, Vladmir C Cordeiro; Fanelli, Marcello Ferretti; Colombo, Pierre-Emmanuel; da Costa, Alexandre André Balieiro Anastácio; Alix-Panabières, Catherine; Chinen, Ludmilla Thomé Domingos. Fusion Cell Markers in Circulating Tumor Cells from Patients with High-Grade Ovarian Serous Carcinoma. International Journal Of Molecular Sciences. 2022;23(23)