Anti ASAH1 pAb (ATL-HPA005468 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005468-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: ASAH1
Alternative Gene Name: AC, ASAH, FLJ21558, PHP32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031591: 82%, ENSRNOG00000010034: 86%
Entrez Gene ID: 427
Uniprot ID: Q13510
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF |
| Gene Sequence | ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF |
| Gene ID - Mouse | ENSMUSG00000031591 |
| Gene ID - Rat | ENSRNOG00000010034 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASAH1 pAb (ATL-HPA005468 w/enhanced validation) | |
| Datasheet | Anti ASAH1 pAb (ATL-HPA005468 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASAH1 pAb (ATL-HPA005468 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASAH1 pAb (ATL-HPA005468 w/enhanced validation) | |
| Datasheet | Anti ASAH1 pAb (ATL-HPA005468 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASAH1 pAb (ATL-HPA005468 w/enhanced validation) |
| Citations for Anti ASAH1 pAb (ATL-HPA005468 w/enhanced validation) – 8 Found |
| Escajadillo, Tamara; Wang, Hongxia; Li, Linda; Li, Donghui; Sewer, Marion B. Oxysterol-related-binding-protein related Protein-2 (ORP2) regulates cortisol biosynthesis and cholesterol homeostasis. Molecular And Cellular Endocrinology. 2016;427( 26992564):73-85. PubMed |
| Lucki, Natasha; Sewer, Marion B. The cAMP-responsive element binding protein (CREB) regulates the expression of acid ceramidase (ASAH1) in H295R human adrenocortical cells. Biochimica Et Biophysica Acta. 2009;1791(8):706-13. PubMed |
| Lucki, Natasha C; Sewer, Marion B. Genistein stimulates MCF-7 breast cancer cell growth by inducing acid ceramidase (ASAH1) gene expression. The Journal Of Biological Chemistry. 2011;286(22):19399-409. PubMed |
| Lucki, Natasha C; Bandyopadhyay, Sibali; Wang, Elaine; Merrill, Alfred H; Sewer, Marion B. Acid ceramidase (ASAH1) is a global regulator of steroidogenic capacity and adrenocortical gene expression. Molecular Endocrinology (Baltimore, Md.). 2012;26(2):228-43. PubMed |
| Lucki, Natasha C; Li, Donghui; Bandyopadhyay, Sibali; Wang, Elaine; Merrill, Alfred H; Sewer, Marion B. Acid ceramidase (ASAH1) represses steroidogenic factor 1-dependent gene transcription in H295R human adrenocortical cells by binding to the receptor. Molecular And Cellular Biology. 2012;32(21):4419-31. PubMed |
| Cai, Kai; Lucki, Natasha C; Sewer, Marion B. Silencing diacylglycerol kinase-theta expression reduces steroid hormone biosynthesis and cholesterol metabolism in human adrenocortical cells. Biochimica Et Biophysica Acta. 2014;1841(4):552-62. PubMed |
| Wilhelm, Raphael; Eckes, Timon; Imre, Gergely; Kippenberger, Stefan; Meissner, Markus; Thomas, Dominique; Trautmann, Sandra; Merlio, Jean-Philippe; Chevret, Edith; Kaufmann, Roland; Pfeilschifter, Josef; Koch, Alexander; Jäger, Manuel. C6 Ceramide (d18:1/6:0) as a Novel Treatment of Cutaneous T Cell Lymphoma. Cancers. 2021;13(2) PubMed |
| Rajput, Kajal; Ansari, Mohammad Nafees; Jha, Somesh K; Pani, Trishna; Medatwal, Nihal; Chattopadhyay, Somdeb; Bajaj, Avinash; Dasgupta, Ujjaini. Ceramide Kinase (CERK) Emerges as a Common Therapeutic Target for Triple Positive and Triple Negative Breast Cancer Cells. Cancers. 2022;14(18) PubMed |