Anti ASAH1 pAb (ATL-HPA005468 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA005468-100

• 
• 

Protein Description: N-acylsphingosine amidohydrolase (acid ceramidase) 1
Gene Name: ASAH1
Alternative Gene Name: AC, ASAH, FLJ21558, PHP32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031591: 82%, ENSRNOG00000010034: 86%
Entrez Gene ID: 427
Uniprot ID: Q13510
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF
• Gene Sequence: ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF
• Gene ID - Mouse: ENSMUSG00000031591
• Gene ID - Rat: ENSRNOG00000010034
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ASAH1 pAb (ATL-HPA005468 w/enhanced validation) – 8 Found

Escajadillo, Tamara; Wang, Hongxia; Li, Linda; Li, Donghui; Sewer, Marion B. Oxysterol-related-binding-protein related Protein-2 (ORP2) regulates cortisol biosynthesis and cholesterol homeostasis. Molecular And Cellular Endocrinology. 2016;427( 26992564):73-85. 

Lucki, Natasha; Sewer, Marion B. The cAMP-responsive element binding protein (CREB) regulates the expression of acid ceramidase (ASAH1) in H295R human adrenocortical cells. Biochimica Et Biophysica Acta. 2009;1791(8):706-13. 

Lucki, Natasha C; Sewer, Marion B. Genistein stimulates MCF-7 breast cancer cell growth by inducing acid ceramidase (ASAH1) gene expression. The Journal Of Biological Chemistry. 2011;286(22):19399-409. 

Lucki, Natasha C; Bandyopadhyay, Sibali; Wang, Elaine; Merrill, Alfred H; Sewer, Marion B. Acid ceramidase (ASAH1) is a global regulator of steroidogenic capacity and adrenocortical gene expression. Molecular Endocrinology (Baltimore, Md.). 2012;26(2):228-43. 

Lucki, Natasha C; Li, Donghui; Bandyopadhyay, Sibali; Wang, Elaine; Merrill, Alfred H; Sewer, Marion B. Acid ceramidase (ASAH1) represses steroidogenic factor 1-dependent gene transcription in H295R human adrenocortical cells by binding to the receptor. Molecular And Cellular Biology. 2012;32(21):4419-31. 

Cai, Kai; Lucki, Natasha C; Sewer, Marion B. Silencing diacylglycerol kinase-theta expression reduces steroid hormone biosynthesis and cholesterol metabolism in human adrenocortical cells. Biochimica Et Biophysica Acta. 2014;1841(4):552-62. 

Wilhelm, Raphael; Eckes, Timon; Imre, Gergely; Kippenberger, Stefan; Meissner, Markus; Thomas, Dominique; Trautmann, Sandra; Merlio, Jean-Philippe; Chevret, Edith; Kaufmann, Roland; Pfeilschifter, Josef; Koch, Alexander; Jäger, Manuel. C6 Ceramide (d18:1/6:0) as a Novel Treatment of Cutaneous T Cell Lymphoma. Cancers. 2021;13(2) 

Rajput, Kajal; Ansari, Mohammad Nafees; Jha, Somesh K; Pani, Trishna; Medatwal, Nihal; Chattopadhyay, Somdeb; Bajaj, Avinash; Dasgupta, Ujjaini. Ceramide Kinase (CERK) Emerges as a Common Therapeutic Target for Triple Positive and Triple Negative Breast Cancer Cells. Cancers. 2022;14(18)