Anti ANKHD1 pAb (ATL-HPA008718)

Atlas Antibodies

Catalog No.:
ATL-HPA008718-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and KH domain containing 1
Gene Name: ANKHD1
Alternative Gene Name: FLJ10042, FLJ11979, FLJ14127, FLJ20288, KIAA1085, MASK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024483: 87%, ENSRNOG00000030247: 83%
Entrez Gene ID: 54882
Uniprot ID: Q8IWZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD
Gene Sequence QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD
Gene ID - Mouse ENSMUSG00000024483
Gene ID - Rat ENSRNOG00000030247
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKHD1 pAb (ATL-HPA008718)
Datasheet Anti ANKHD1 pAb (ATL-HPA008718) Datasheet (External Link)
Vendor Page Anti ANKHD1 pAb (ATL-HPA008718) at Atlas Antibodies

Documents & Links for Anti ANKHD1 pAb (ATL-HPA008718)
Datasheet Anti ANKHD1 pAb (ATL-HPA008718) Datasheet (External Link)
Vendor Page Anti ANKHD1 pAb (ATL-HPA008718)
Citations for Anti ANKHD1 pAb (ATL-HPA008718) – 2 Found
Fragiadaki, Maria; Zeidler, Martin P. Ankyrin repeat and single KH domain 1 (ANKHD1) drives renal cancer cell proliferation via binding to and altering a subset of miRNAs. The Journal Of Biological Chemistry. 2018;293(25):9570-9579.  PubMed
Fisher, Katherine H; Fragiadaki, Maria; Pugazhendhi, Dhamayanthi; Bausek, Nina; Arredondo, Maria A; Thomas, Sally J; Brown, Stephen; Zeidler, Martin P. A genome-wide RNAi screen identifies MASK as a positive regulator of cytokine receptor stability. Journal Of Cell Science. 2018;131(13)  PubMed