Anti ANKHD1 pAb (ATL-HPA008718)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008718-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ANKHD1
Alternative Gene Name: FLJ10042, FLJ11979, FLJ14127, FLJ20288, KIAA1085, MASK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024483: 87%, ENSRNOG00000030247: 83%
Entrez Gene ID: 54882
Uniprot ID: Q8IWZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD |
Gene Sequence | QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD |
Gene ID - Mouse | ENSMUSG00000024483 |
Gene ID - Rat | ENSRNOG00000030247 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANKHD1 pAb (ATL-HPA008718) | |
Datasheet | Anti ANKHD1 pAb (ATL-HPA008718) Datasheet (External Link) |
Vendor Page | Anti ANKHD1 pAb (ATL-HPA008718) at Atlas Antibodies |
Documents & Links for Anti ANKHD1 pAb (ATL-HPA008718) | |
Datasheet | Anti ANKHD1 pAb (ATL-HPA008718) Datasheet (External Link) |
Vendor Page | Anti ANKHD1 pAb (ATL-HPA008718) |
Citations for Anti ANKHD1 pAb (ATL-HPA008718) – 2 Found |
Fragiadaki, Maria; Zeidler, Martin P. Ankyrin repeat and single KH domain 1 (ANKHD1) drives renal cancer cell proliferation via binding to and altering a subset of miRNAs. The Journal Of Biological Chemistry. 2018;293(25):9570-9579. PubMed |
Fisher, Katherine H; Fragiadaki, Maria; Pugazhendhi, Dhamayanthi; Bausek, Nina; Arredondo, Maria A; Thomas, Sally J; Brown, Stephen; Zeidler, Martin P. A genome-wide RNAi screen identifies MASK as a positive regulator of cytokine receptor stability. Journal Of Cell Science. 2018;131(13) PubMed |