Endocrine & Metabolism

  • Anti AFP mAb (Clone 6D2)

    Cosmo Bio LTD

    Anti AFP mAb (Clone 6D2)

    Catalog No.(s): LNM-KR-005

    Application: ELISA Clonality: Monoclonal Host: Mouse Purification: Purified - Affinity Reactivity: Human 

    $168.00
    Choose Options
  • Leptin, Human ELISA Kit, pink-ONE

    LABISKOMA

    Leptin, Human ELISA Kit, pink-ONE

    Catalog No.(s): KBT-K0332113P

    Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Human Description: Human...

    $460.00
    Choose Options
  • Leptin, Human ELISA Kit

    LABISKOMA

    Leptin, Human ELISA Kit

    Catalog No.(s): KBT-K0332113

    Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Human Description: Human...

    $417.00
    Choose Options
  • Leptin, Mouse, ELISA Kit, pink-ONE

    LABISKOMA

    Leptin, Mouse, ELISA Kit, pink-ONE

    Catalog No.(s): KBT-K0331250P

    Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Mouse Description: Mouse...

    $460.00
    Choose Options
  • Leptin, Mouse, ELISA Kit

    LABISKOMA

    Leptin, Mouse, ELISA Kit

    Catalog No.(s): KBT-K0331250

    Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Mouse Description: Mouse...

    $417.00
    Choose Options
  • Insulin Like Growth Factor-I (IGF-I) Mouse, ELISA Kit, pink-ONE

    LABISKOMA

    Insulin Like Growth Factor-I (IGF-I) Mouse, ELISA Kit, pink-ONE

    Catalog No.(s): KBT-K0331225P

    Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Mouse Description: Mouse IGF-I ELISA Kit contains all components required for the quantitative measurement of natural and/or recombinant...

    $460.00
    Choose Options
  • Insulin Like Growth Factor-I (IGF-I) Mouse, ELISA Kit

    LABISKOMA

    Insulin Like Growth Factor-I (IGF-I) Mouse, ELISA Kit

    Catalog No.(s): KBT-K0331225

    Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Reactivity: Mouse Description: Mouse IGF-I ELISA Kit contains all components required for the quantitative measurement of natural and/or recombinant...

    $417.00
    Choose Options
  • Anti Prei4 pAb

    Cosmo Bio LTD

    Anti Prei4 pAb

    Catalog No.(s): KAL-KG406

    Click here to view the KAL dashboard pageApplication: IHC(p) Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Mouse 

    $749.00
    Choose Options
  • Anti Leprotl1 pAb

    Cosmo Bio LTD

    Anti Leprotl1 pAb

    Catalog No.(s): KAL-KG405

    Click here to view the KAL dashboard pageApplication: IHC(p) Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Mouse 

    $749.00
    Choose Options
  • Anti GPR40 mAb (Clone G16)

    Cosmo Bio LTD

    Anti GPR40 mAb (Clone G16)

    Catalog No.(s): KAL-KG116

    Click here to view the KAL dashboard pageApplication: ICC, IF Clonality: Monoclonal Host: Mouse Purification: Ig-PG Reactivity: Mouse, Human 

    $780.00
    Choose Options
  • Anti Metallothionein mAb (Clone 1A12, Biotin Labeled)

    Cosmo Bio LTD

    Anti Metallothionein mAb (Clone 1A12, Biotin Labeled)

    Catalog No.(s): KAL-KA009-01

    Click here to view the KAL dashboard pageApplication: WB Clonality: Monoclonal Conjugation: Biotin Host: Mouse Purification: Purified - Affinity Reactivity: Rabbit, Mouse, Rat, Human  Metallothinein(MT), a...

    $895.00
    Choose Options
  • Anti Metallothionein mAb (Clone 1A12)

    Cosmo Bio LTD

    Anti Metallothionein mAb (Clone 1A12)

    Catalog No.(s): KAL-KA009

    Click here to view the KAL dashboard pageApplication: WB Clonality: Monoclonal Host: Mouse Purification: Purified - Affinity Reactivity: Rabbit, Mouse, Rat, Human  Metallothinein(MT), a cysteine-rich(30%), metal-binding...

    $505.00
    Choose Options
  • 2-Deoxyglucose (2DG) Uptake Measurement Kit

    Cosmo Bio LTD

    2-Deoxyglucose (2DG) Uptake Measurement Kit

    Catalog No.(s): CSR-OKP-PMG-K01, CSR-OKP-PMG-K01H

    2-deoxyglucose uptake measurement is a reliable approach for estimating glucose uptake in cells and tissues. ...

    Based on a published method, the 2-Deoxyglucose (2DG) Uptake Measurement Kit facilitates highly sensitive and direct enzymatic 2DG quantitation, obviating the need for radioisotopes and their attendant issues....

    $524.00 - $867.00
    Choose Options
  • Glucose Cellular Uptake Measurement Kit (Broad Range, Fluorometric)

    Cosmo Bio LTD

    Glucose Cellular Uptake Measurement Kit (Broad Range, Fluorometric)

    Catalog No.(s): CSR-MBR-PMG-K01

    A complete reagent set to measure 2DG in cells after cell lysis by sonication Insulin is a hormone that lowers the blood glucose level and is known to help glucose enter cells through an effect that enhances the activity of glucose transport, primarily...

    $1,057.00
    Choose Options
  • Transthyretin (Met)

    Cosmo Bio LTD

    Transthyretin (Met)

    Catalog No.(s): CSR-KN-TOYU-M02

    Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

    $280.00
    Choose Options
  • Transthyretin (His-Tag)

    Cosmo Bio LTD

    Transthyretin (His-Tag)

    Catalog No.(s): CSR-KN-TOYU-M01

    Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

    $280.00
    Choose Options
  • Testosterone (T) ELISA Kit (guinea pig)

    CusaBio

    Testosterone (T) ELISA Kit (guinea pig)

    Catalog No.(s): CSB-EQ028156GU-1, CSB-EQ028156GU-5, CSB-EQ028156GU-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $495.00 - $4,087.00
    Choose Options
  • Estradiol (E2) ELISA Kit (horse)

    CusaBio

    Estradiol (E2) ELISA Kit (horse)

    Catalog No.(s): CSB-EQ027953HO-1, CSB-EQ027953HO-5, CSB-EQ027953HO-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $495.00 - $4,087.00
    Choose Options
  • Estradiol (E2) ELISA Kit (guinea pig)

    CusaBio

    Estradiol (E2) ELISA Kit (guinea pig)

    Catalog No.(s): CSB-EQ027953GU-1, CSB-EQ027953GU-5, CSB-EQ027953GU-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $495.00 - $4,087.00
    Choose Options
  • Estradiol (E2) ELISA Kit (duck)

    CusaBio

    Estradiol (E2) ELISA Kit (duck)

    Catalog No.(s): CSB-EQ027953DU-1, CSB-EQ027953DU-5, CSB-EQ027953DU-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $485.00 - $4,004.00
    Choose Options
  • Rabbit Creatine Kinase MB Isoenzyme (CK-MB) ELISA Kit

    CusaBio

    Rabbit Creatine Kinase MB Isoenzyme (CK-MB) ELISA Kit

    Catalog No.(s): CSB-EQ027653RB-1, CSB-EQ027653RB-5, CSB-EQ027653RB-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $595.00 - $4,684.00
    Choose Options
  • Pig Creatine Kinase MB Isoenzyme (CK-MB) ELISA Kit

    CusaBio

    Pig Creatine Kinase MB Isoenzyme (CK-MB) ELISA Kit

    Catalog No.(s): CSB-EQ027653PI-1, CSB-EQ027653PI-5, CSB-EQ027653PI-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $790.00 - $5,309.00
    Choose Options
  • Corticosterone (CORT) ELISA Kit (sheep)

    CusaBio

    Corticosterone (CORT) ELISA Kit (sheep)

    Catalog No.(s): CSB-EQ027629SH-1, CSB-EQ027629SH-5, CSB-EQ027629SH-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $595.00 - $4,684.00
    Choose Options
  • Corticosterone (CORT) ELISA Kit (goat)

    CusaBio

    Corticosterone (CORT) ELISA Kit (goat)

    Catalog No.(s): CSB-EQ027629GO-1, CSB-EQ027629GO-5, CSB-EQ027629GO-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $790.00 - $5,309.00
    Choose Options
  • Cortisol ELISA Kit (monkey)

    CusaBio

    Cortisol ELISA Kit (monkey)

    Catalog No.(s): CSB-EQ027342MK-1, CSB-EQ027342MK-5, CSB-EQ027342MK-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $790.00 - $5,309.00
    Choose Options
  • Cortisol ELISA Kit (horse)

    CusaBio

    Cortisol ELISA Kit (horse)

    Catalog No.(s): CSB-EQ027342HO-1, CSB-EQ027342HO-5, CSB-EQ027342HO-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $595.00 - $4,684.00
    Choose Options