Protein Description: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Gene Name: ITGA2B
Alternative Gene Name: CD41, CD41B, GP2B
Sequence: FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV
Interspecies mouse/rat: ENSMUSG00000034664: 77%, ENSRNOG00000022071: 77%
Entrez Gene ID: 3674
Uniprot ID: P08514
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ITGA2B
Alternative Gene Name: CD41, CD41B, GP2B
Sequence: FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV
Interspecies mouse/rat: ENSMUSG00000034664: 77%, ENSRNOG00000022071: 77%
Entrez Gene ID: 3674
Uniprot ID: P08514
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen ITGA2B (ATL-APrEST78038) | |
Antibody | Anti ITGA2B pAb (ATL-HPA031171 w/enhanced validation) |
Documents & Links for PrEST Antigen ITGA2B (ATL-APrEST78038) | |
Datasheet | PrEST Antigen ITGA2B (ATL-APrEST78038) Datasheet (External Link) |
Vendor Page | PrEST Antigen ITGA2B (ATL-APrEST78038) at Atlas |
Documents & Links for PrEST Antigen ITGA2B (ATL-APrEST78038) | |
Datasheet | PrEST Antigen ITGA2B (ATL-APrEST78038) Datasheet (External Link) |
Vendor Page | PrEST Antigen ITGA2B (ATL-APrEST78038) |