Protein Description: ankyrin repeat and BTB (POZ) domain containing 2
Gene Name: ABTB2
Alternative Gene Name: DKFZP586C1619
Sequence: IPTTDILELLSAASLFQLDALQRHCEILCSQTLSMESAVNTYKYAKIHNAPELALFCEGFFLKHMKALLEQDA
Interspecies mouse/rat: ENSMUSG00000032724: 95%, ENSRNOG00000008510: 95%
Entrez Gene ID: 25841
Uniprot ID: Q8N961
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ABTB2
Alternative Gene Name: DKFZP586C1619
Sequence: IPTTDILELLSAASLFQLDALQRHCEILCSQTLSMESAVNTYKYAKIHNAPELALFCEGFFLKHMKALLEQDA
Interspecies mouse/rat: ENSMUSG00000032724: 95%, ENSRNOG00000008510: 95%
Entrez Gene ID: 25841
Uniprot ID: Q8N961
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ABTB2 (ATL-APrEST73997) | |
| Antibody | Anti ABTB2 pAb (ATL-HPA020065) |
| Documents & Links for PrEST Antigen ABTB2 (ATL-APrEST73997) | |
| Datasheet | PrEST Antigen ABTB2 (ATL-APrEST73997) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ABTB2 (ATL-APrEST73997) at Atlas |
| Documents & Links for PrEST Antigen ABTB2 (ATL-APrEST73997) | |
| Datasheet | PrEST Antigen ABTB2 (ATL-APrEST73997) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ABTB2 (ATL-APrEST73997) |