Neurodegeneration

Cosmo Bio LTD

Anti Mitofusin 2 (MFN2) pAb (Rabbit, Purified Ig)

Catalog No.(s): PRX-MKA0214PA

About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page...

Cosmo Bio LTD

Anti Mitofusin 2 (MFN2) pAb (Rabbit, Antiserum)

Catalog No.(s): PRX-MKA0214

About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page...

Cosmo Bio LTD

Anti WASH Complex Subunit 5 (WASHC5) pAb (Rabbit, Purified Ig)

Catalog No.(s): PRX-MKA0196PA

About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page...

Cosmo Bio LTD

Anti WASH Complex Subunit 5 (WASHC5) pAb (Rabbit, Antiserum)

Catalog No.(s): PRX-MKA0196

About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page...

Cosmo Bio LTD

Anti Pumilio RNA Binding Family Member 1 (PUM1) pAb (Rabbit, Purified Ig)

Catalog No.(s): PRX-MKA0099PA

About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page...

Cosmo Bio LTD

Anti Pumilio RNA Binding Family Member 1 (PUM1) pAb (Rabbit, Antiserum)

Catalog No.(s): PRX-MKA0099

About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page...

Cosmo Bio LTD

Anti Lysyl-TRNA Synthetase (KARS) pAb (Rabbit, Purified Ig)

Catalog No.(s): PRX-MKA0070PA

About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page...

Cosmo Bio LTD

Anti Lysyl-TRNA Synthetase (KARS) pAb (Rabbit, Antiserum)

Catalog No.(s): PRX-MKA0070

About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page...

Cosmo Bio LTD

Anti Synaptojanin 1 (SYNJ1) pAb (Rabbit, Affinity Purified)

Catalog No.(s): PRX-MK09100910

About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page...

Cosmo Bio LTD

Anti Optineurin (OPTN) pAb (Rabbit, Antiserum)

Catalog No.(s): PRX-KB9422GNP

About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page...

Cosmo Bio LTD

Anti 4-Hydroxynonenal (HNE) mAb (Clone HNEJ-2)

Catalog No.(s): NNS-MHN-020P-EX, NNS-MHN-100P-EX

Application: IHC, WB Clonality: Monoclonal Host: Mouse 

Cosmo Bio LTD

Anti GM3 mAb (Clone M2590)

Catalog No.(s): NBT-M102

Previous catalog number NBT-M102...

Cosmo Bio LTD

Anti Prion Protein B pAb

Catalog No.(s): LSL-LB-3227

Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard PageApplication: ELISA, IF, WB Clonality: Polyclonal Host: Rabbit Purification: Serum Reactivity: Farm Animal - Other, Bovine, Mouse, Rat,...

Cosmo Bio LTD

Anti Prion Protein A pAb

Catalog No.(s): LSL-LB-3117

Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard PageApplication: ELISA, IF, WB Clonality: Polyclonal Host: Rabbit Purification: Serum Reactivity: Farm Animal - Other, Bovine, Mouse, Rat,...

Cosmo Bio LTD

Anti Estradiol 17-Beta-Dehydrogenase 8 (HSD17B8) pAb (Rabbit, Affinity Purified)

Catalog No.(s): KAL-KR099

Click here to view the KAL dashboard pageApplication: IHC Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Human 

Cosmo Bio LTD

Anti Tau, phospho Ser416 pAb

Catalog No.(s): KAL-KR076

Visit our Neurodegeneration Products homepage to browse related research productsClick here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: IHC Clonality: Polyclonal Host:...

4BioDx

Anti-APP [pT668] pAb

Catalog No.(s): BDX-4BDX-1503S, BDX-4BDX-1503

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageApplication: IHC, IF, WB Clonality: Polyclonal Host: Rabbit Reactivity: Rat, Mouse, Human Rabbit...

4BioDx

Anti-Tau [pS199] pAb

Catalog No.(s): BDX-4BDX-1502S, BDX-4BDX-1502

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageApplication: IHC, IF, WB Clonality: Polyclonal Host: Rabbit Reactivity: Rat, Mouse, Human Rabbit...

4BioDx

Anti-Tau mAb [pS422] (clone 2H9)

Catalog No.(s): BDX-4BDX-1501, BDX-4BDX-1501S

Visit our Neurodegeneration Products homepage to browse related research productsClick here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Click here for the Neuroscience Products Dashboard...

Cosmo Bio LTD

Alpha-Synuclein, Recombinant, Human

Catalog No.(s): CSR-SYN04-2, CSR-SYN04-1

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageE. coli expressed human α-synuclein has been widely used in structural and functional studies. Masuda et. al...

Cosmo Bio LTD

Alpha-Synuclein Fibrils, Human

Catalog No.(s): CSR-SYN03

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Pageα-Synuclein Fibrils, HumanThis product is sonicated, preformed human α-synuclein fibrils confirmed to...

Cosmo Bio LTD

Amyloid Fluorescent Staining Kit

Catalog No.(s): CSR-SYN02

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageThe Amyloid Fluorescent Staining Kit for histological staining employs a green fluorescent dye that selectively...

Cosmo Bio LTD

Alpha-Synuclein Aggregation Assay Kit

Catalog No.(s): CSR-SYN01

Contains all key reagents needed to promote the formation of aggregates in cultured cells resembling patient aggregates; by the seeded aggregation technique of Nonaka et. al (2010). Sufficient for 400 tests....

Cosmo Bio LTD

Amyloid Beta Peptide 42

Catalog No.(s): CSR-KN-TOYU-M04

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAWarning:...

Cosmo Bio LTD

Amyloid Beta Peptide 40

Catalog No.(s): CSR-KN-TOYU-M03

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVWarning:...

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

CusaBio

Alpha II-spectrin breakdown product SBDP145 ELISA Kit (human)

Catalog No.(s): CSB-EQ028022HU-1, CSB-EQ028022HU-5, CSB-EQ028022HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (horse)

Catalog No.(s): CSB-EQ027953HO-1, CSB-EQ027953HO-5, CSB-EQ027953HO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (guinea pig)

Catalog No.(s): CSB-EQ027953GU-1, CSB-EQ027953GU-5, CSB-EQ027953GU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (duck)

Catalog No.(s): CSB-EQ027953DU-1, CSB-EQ027953DU-5, CSB-EQ027953DU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Alzheimer-associated neuronal thread protein (AD7C-NTP) ELISA Kit (human)

Catalog No.(s): CSB-EQ027774HU-1, CSB-EQ027774HU-5, CSB-EQ027774HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Soluble Amyloid Precursor Protein Alpha (sAPPα) ELISA Kit (human)

Catalog No.(s): CSB-EQ027464HU-1, CSB-EQ027464HU-5, CSB-EQ027464HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

4-Hydroxynonenal (HNE) ELISA Kit (rat)

Catalog No.(s): CSB-EQ027232RA-1, CSB-EQ027232RA-5, CSB-EQ027232RA-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Mouse Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-EL025270MO-1, CSB-EL025270MO-5, CSB-EL025270MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...