Visual System

Cosmo Bio LTD

Anti Rhodopsin (Bovine) pAb

Catalog No.(s): LSL-LB-5597

Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard PageApplication: ELISA, IF Clonality: Polyclonal Host: Rabbit Purification: Serum Reactivity: Aquatic & Amphibian, Avian, Bovine, Mouse,...

Cosmo Bio LTD

Anti Rhodopsin pAb

Catalog No.(s): LSL-LB-5555

Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard PageApplication: ELISA, IF, WB Clonality: Polyclonal Host: Rabbit Purification: Serum Reactivity: Aquatic & Amphibian, Avian, Bovine,...

Cosmo Bio LTD

Anti Rhodopsin (RHO) pAb (Rabbit, Antiserum)

Catalog No.(s): LSL-LB-5533

Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard PageApplication: ELISA, IF, WB Clonality: Polyclonal Host: Rabbit Purification: Serum Reactivity: Drosophila 

Cosmo Bio LTD

Anti Rhodopsin (Molluscan) pAb

Catalog No.(s): LSL-LB-5509

Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard PageApplication: ELISA, IF Clonality: Polyclonal Host: Rabbit Purification: Serum Reactivity: Aquatic & Amphibian 

LABISKOMA

Vascular Endothelial Cell Growth Factor-A (VEGF-A) Equine, ELISA Kit

Catalog No.(s): KBT-K0333016

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Equine Description: Horse...

LABISKOMA

Vascular Endothelial Cell Growth Factor-A (VEGF-A) Bovine, ELISA Kit

Catalog No.(s): KBT-K0333006

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Bovine Description: Bovine...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Rat, ELISA Kit, pink-ONE

Catalog No.(s): KBT-K0331261P

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Rat Description: Rat VEGF...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Rat, ELISA Kit

Catalog No.(s): KBT-K0331261

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Rat Description: Rat VEGF...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Mouse, ELISA Kit, pink-ONE

Catalog No.(s): KBT-K0331224P

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Mouse Description: Mouse...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Mouse, ELISA Kit

Catalog No.(s): KBT-K0331224

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Mouse Description: Mouse...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Human, ELISA Kit, pink-ONE

Catalog No.(s): KBT-K0331132P

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Human Description: Human...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Human, ELISA Kit

Catalog No.(s): KBT-K0331132

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Reactivity: Human Description: Human...

Cosmo Bio LTD

Anti Keratin 12 pAb

Catalog No.(s): KAL-KR074

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Click here to view the KAL dashboard pageApplication: IHC Clonality: Polyclonal Host: Rabbit Purification: Purified -...

Cosmo Bio LTD

Sodium Keratan Sulfate (Nasal Cartilage)

Catalog No.(s): CSR-NAKS2(PNC)1, CSR-NAKS2(PNC)3

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.

Cosmo Bio LTD

Sodium Keratan Sulfate (Shark Cartilage)

Catalog No.(s): CSR-NAKPS2(SHC)1, CSR-NAKPS2(SHC)3

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.

Cosmo Bio LTD

Tear Mucin Assay Kit (O-Glycan assay method)

Catalog No.(s): CSR-MUC01

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research. Tear Mucin Assay Kit (O-Glycan Assay Method)A kit to extract and fluorometrically determine the amount of mucin content in tearBackgroundMucins...

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

CusaBio

Mouse Alpha-Enolase (ENO1) Antibody (IgG) ELISA Kit

Catalog No.(s): CSB-EQ027778MO-1, CSB-EQ027778MO-5, CSB-EQ027778MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Alpha-Enolase (ENO1) Antibody (IgA) ELISA Kit

Catalog No.(s): CSB-EQ027777HU-1, CSB-EQ027777HU-5, CSB-EQ027777HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Alpha-Enolase (ENO1) Antibody (IgM) ELISA Kit

Catalog No.(s): CSB-EQ027776HU-1, CSB-EQ027776HU-5, CSB-EQ027776HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Alpha-Enolase (ENO1) Antibody (IgG) ELISA Kit

Catalog No.(s): CSB-EQ027775HU-1, CSB-EQ027775HU-5, CSB-EQ027775HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit (bovine)

Catalog No.(s): CSB-EL025833BO-1, CSB-EL025833BO-5, CSB-EL025833BO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Mouse Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-EL025270MO-1, CSB-EL025270MO-5, CSB-EL025270MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Bovine Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-EL025270BO-1, CSB-EL025270BO-5, CSB-EL025270BO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Troponin I, fast skeletal muscle (TNNI2) ELISA Kit

Catalog No.(s): CSB-EL024012HU-1, CSB-EL024012HU-5, CSB-EL024012HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Paired Box 6 (PAX6) ELISA Kit (mouse)

Catalog No.(s): CSB-EL017492MO-1, CSB-EL017492MO-5, CSB-EL017492MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Fatty acid-binding protein 12 (FABP12) ELISA Kit

Catalog No.(s): CSB-EL007941HU-1, CSB-EL007941HU-5, CSB-EL007941HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Mouse Alpha-Enolase (ENO1) ELISA Kit

Catalog No.(s): CSB-EL007670MO-1, CSB-EL007670MO-5, CSB-EL007670MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Decorin (DCN) ELISA Kit (mouse)

Catalog No.(s): CSB-EL006554MO-1, CSB-EL006554MO-5, CSB-EL006554MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Alpha-Crystallin B Chain (CRYAB) ELISA Kit

Catalog No.(s): CSB-EL006008HU-1, CSB-EL006008HU-5, CSB-EL006008HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Rat Alpha-Enolase ELISA Kit

Catalog No.(s): CSB-E17439r-1, CSB-E17439r-5, CSB-E17439r-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Alpha-Enolase (ENO1/ENO1L1/MBPB1/MPB1) ELISA Kit

Catalog No.(s): CSB-E17177h-1, CSB-E17177h-5, CSB-E17177h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Decorin/Bone Proteoglycan II (DCN) ELISA Kit (human)

Catalog No.(s): CSB-E16522h-1, CSB-E16522h-5, CSB-E16522h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Vascular Endothelial Cell Growth Factor (VEGF) ELISA Kit (monkey)

Catalog No.(s): CSB-E16502Mk-1, CSB-E16502Mk-5, CSB-E16502Mk-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...