PrEST Antigen DIS3 (ATL-APrEST91947)

Catalog No:
ATL-APrEST91947-100
$290.00
Protein Description: DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease
Gene Name: DIS3
Alternative Gene Name: dis3p, EXOSC11, KIAA1008, RRP44
Sequence: LSSNLCSLKCDVDRLAFSCIWEMNHNAEILKTKFTKSVINSKASLTYAEAQLRIDSANMNDDITTSLRGLNKLAKILKKRRIEKGALTLSSPEV
Interspecies mouse/rat: ENSMUSG00000033166: 90%, ENSRNOG00000009125: 90%
Entrez Gene ID: 22894
Uniprot ID: Q9Y2L1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Cognate Antibody/Antigen for PrEST Antigen DIS3 (ATL-APrEST91947)
Antibody Anti DIS3 pAb (ATL-HPA058762)
Documents & Links for PrEST Antigen DIS3 (ATL-APrEST91947)
Datasheet PrEST Antigen DIS3 (ATL-APrEST91947) Datasheet (External Link)
Vendor Page PrEST Antigen DIS3 (ATL-APrEST91947) at Atlas

Documents & Links for PrEST Antigen DIS3 (ATL-APrEST91947)
Datasheet PrEST Antigen DIS3 (ATL-APrEST91947) Datasheet (External Link)
Vendor Page PrEST Antigen DIS3 (ATL-APrEST91947)