Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA073224-25
  • Immunohistochemistry analysis in human adrenal gland and liver tissues using HPA073224 antibody. Corresponding SLC18A2 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: solute carrier family 18 member A2
Gene Name: SLC18A2
Alternative Gene Name: SVAT, SVMT, VMAT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025094: 89%, ENSRNOG00000008890: 94%
Entrez Gene ID: 6571
Uniprot ID: Q05940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Gene Sequence MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Gene ID - Mouse ENSMUSG00000025094
Gene ID - Rat ENSRNOG00000008890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation)
Datasheet Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC18A2 pAb (ATL-HPA073224 w/enhanced validation)