Anti GANAB pAb (ATL-HPA061426 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061426-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GANAB
Alternative Gene Name: G2AN, GluII, KIAA0088
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071650: 68%, ENSRNOG00000024563: 35%
Entrez Gene ID: 23193
Uniprot ID: Q14697
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDG |
| Gene Sequence | GRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDG |
| Gene ID - Mouse | ENSMUSG00000071650 |
| Gene ID - Rat | ENSRNOG00000024563 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GANAB pAb (ATL-HPA061426 w/enhanced validation) | |
| Datasheet | Anti GANAB pAb (ATL-HPA061426 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GANAB pAb (ATL-HPA061426 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GANAB pAb (ATL-HPA061426 w/enhanced validation) | |
| Datasheet | Anti GANAB pAb (ATL-HPA061426 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GANAB pAb (ATL-HPA061426 w/enhanced validation) |
| Citations for Anti GANAB pAb (ATL-HPA061426 w/enhanced validation) – 1 Found |
| Ju, Mingyi; Qi, Aoshuang; Bi, Jia; Zhao, Lan; Jiang, Longyang; Zhang, Qiang; Wei, Qian; Guan, Qiutong; Li, Xueping; Wang, Lin; Wei, Minjie; Zhao, Lin. A five-mRNA signature associated with post-translational modifications can better predict recurrence and survival in cervical cancer. Journal Of Cellular And Molecular Medicine. 2020;24(11):6283-6297. PubMed |