Neurodegeneration

  • Ubiquigent

    Optineurin [GST-tagged]

    Catalog No.(s): UBI-66-1005-050

    Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research. Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

    $440.00
    Choose Options
  • Parkin (human; full length), pAb

    Ubiquigent

    Parkin (human; full length), pAb

    Catalog No.(s): UBI-68-0018-100

    Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research. Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

    $573.00
    Choose Options
  • Ubiquigent

    Parkin [untagged]

    Catalog No.(s): UBI-63-0048-025

    Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research. Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

    $573.00
    Choose Options
  • Parkin pSer65 (human; residues 60 - 72), pAb

    Ubiquigent

    Parkin pSer65 (human; residues 60 - 72), pAb

    Catalog No.(s): UBI-68-0056-100

    Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research. Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

    $573.00
    Choose Options
  • Ubiquigent

    PINK1 (D359A) [MBP-tagged]

    Catalog No.(s): UBI-66-0044-050

    Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

    $573.00
    Choose Options
  • PINK1 (human; residues 175 – 250), pAb

    Ubiquigent

    PINK1 (human; residues 175 – 250), pAb

    Catalog No.(s): UBI-68-0019-100

    Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research. Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

    $573.00
    Choose Options
  • Ubiquigent

    PINK1 [MBP-tagged]

    Catalog No.(s): UBI-66-0043-050

    PINK1 [MBP-tagged] is a functional, Tribolium castaneum (red flour beetle), N-terminal myelin basic protein-tagged, E. coli-expressed, recombinant protein....

    Identity was confirmed, by mass spectroscopy and activity by direct and indirect kinase assays....

    $573.00
    Choose Options
  • PINK1 pThr257 (human; residues 250 - 262), pAb

    Ubiquigent

    PINK1 pThr257 (human; residues 250 - 262), pAb

    Catalog No.(s): UBI-68-0057-100

    Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research. Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

    $573.00
    Choose Options
  • Rat Aspartate Aminotransferase (AST) ELISA Kit

    CusaBio

    Rat Aspartate Aminotransferase (AST) ELISA Kit

    Catalog No.(s): CSB-E13023r-1, CSB-E13023r-5, CSB-E13023r-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $790.00 - $5,309.00
    Choose Options
  • Rat Prealbumin (PA) ELISA Kit

    CusaBio

    Rat Prealbumin (PA) ELISA Kit

    Catalog No.(s): CSB-E13251r-1, CSB-E13251r-5, CSB-E13251r-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $790.00 - $5,309.00
    Choose Options
  • Soluble Amyloid Precursor Protein Alpha (sAPPα) ELISA Kit (human)

    CusaBio

    Soluble Amyloid Precursor Protein Alpha (sAPPα) ELISA Kit (human)

    Catalog No.(s): CSB-EQ027464HU-1, CSB-EQ027464HU-5, CSB-EQ027464HU-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $695.00 - $4,937.00
    Choose Options
  • TAR DNA-binding protein 43 (TARDBP/TDP-43) ELISA Kit (human)

    CusaBio

    TAR DNA-binding protein 43 (TARDBP/TDP-43) ELISA Kit (human)

    Catalog No.(s): CSB-E17007h-1, CSB-E17007h-5, CSB-E17007h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $695.00 - $4,937.00
    Choose Options
  • Tau proteins ELISA Kit (human)

    CusaBio

    Tau proteins ELISA Kit (human)

    Catalog No.(s): CSB-E12011h-1, CSB-E12011h-5, CSB-E12011h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $790.00 - $5,309.00
    Choose Options
  • Tau Proteins ELISA Kit (rat)

    CusaBio

    Tau Proteins ELISA Kit (rat)

    Catalog No.(s): CSB-E13729r-1, CSB-E13729r-5, CSB-E13729r-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $790.00 - $5,309.00
    Choose Options
  • TBK1 (human; full length), pAb

    Ubiquigent

    TBK1 (human; full length), pAb

    Catalog No.(s): UBI-68-0053-100

    Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may be subject to unpredictable wait times. Please contact...

    $573.00
    Choose Options
  • Ubiquigent

    TBK1 [GST-tagged]

    Catalog No.(s): UBI-66-0016-050

    Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may be subject to unpredictable wait times. Please contact...

    $440.00
    Choose Options
  • TBK1 pSer172 (human; residues 168 – 177), pAb

    Ubiquigent

    TBK1 pSer172 (human; residues 168 – 177), pAb

    Catalog No.(s): UBI-68-0054-100

    Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total at least $700 to enable prompt delivery. Orders less than this amount may be subject to unpredictable wait times. Please contact...

    $573.00
    Choose Options
  • Transthyretin (His-Tag)

    Cosmo Bio LTD

    Transthyretin (His-Tag)

    Catalog No.(s): CSR-KN-TOYU-M01

    Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

    $280.00
    Choose Options
  • Transthyretin (Met)

    Cosmo Bio LTD

    Transthyretin (Met)

    Catalog No.(s): CSR-KN-TOYU-M02

    Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

    $280.00
    Choose Options