Alzheimer's Disease

CusaBio

Endothelial Nitric Oxide Synthase (eNOS/NOS3) ELISA Kit (mouse)

Catalog No.(s): CSB-E08324m-1, CSB-E08324m-5, CSB-E08324m-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Endothelial Nitric Oxide Synthase (eNOS/NOS3) ELISA Kit (pig)

Catalog No.(s): CSB-E08574p-1, CSB-E08574p-5, CSB-E08574p-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

LABISKOMA

EzWay Direct ApoE Genotyping Kit

Catalog No.(s): KBT-K0568500

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Features:  ApoE genotyping directly from blood. One-step Multiplex PCR system with PrimerMix ApoE primer mixture for E2 (Cys112/Cys158), E3...

CusaBio

Heat Shock Cognate 71 kDa Protein (HSPA8) ELISA Kit (human)

Catalog No.(s): CSB-EL010829HU-1, CSB-EL010829HU-5, CSB-EL010829HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Heat Shock Cognate 71 kDa Protein (HSPA8) N-terminal 6xHis-tagged (yeast-derived, recombinant human)

Catalog No.(s): CSB-YP010829HU-20, CSB-YP010829HU-100, CSB-YP010829HU-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Human Beta-Site APP-Cleaving Enzyme 1 (BACE1) ELISA Kit

Catalog No.(s): CSB-E09824h-1, CSB-E09824h-5, CSB-E09824h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Calbindin(CALB1) ELISA kit

Catalog No.(s): CSB-EL004432HU-1, CSB-EL004432HU-5, CSB-EL004432HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Metallothionein,MT ELISA Kit

Catalog No.(s): CSB-E09060h-1, CSB-E09060h-5, CSB-E09060h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Metallothionein-2(MT-2) ELISA Kit

Catalog No.(s): CSB-E13535h-1, CSB-E13535h-5, CSB-E13535h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human myeloperoxidase,MPO ELISA Kit

Catalog No.(s): CSB-E08721h-1, CSB-E08721h-5, CSB-E08721h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CUSAg

Human Prealbumin

Catalog No.(s): CSB-DP322B

Type: Active AntigenFunction: Liver Function & InjuryApplication: Calibrator, WBPurity: >90% by SDS-PAGELead Time: 3-20 Working daysStorage Buffer: Supplied in liquid form dissolved in PBS pH 7.4Form: LiquidStorage Conditions: Aliquot and store at -20 or...

CusaBio

Human protein disulfide isomerase,PDI ELISA Kit

Catalog No.(s): CSB-E09003h-1, CSB-E09003h-5, CSB-E09003h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-E11169h-1, CSB-E11169h-5, CSB-E11169h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Metallothionein (MT) ELISA Kit (fish)

Catalog No.(s): CSB-EQ027262FI-1, CSB-EQ027262FI-5, CSB-EQ027262FI-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Mouse Metallothionein-2(MT-2) ELISA Kit

Catalog No.(s): CSB-E13693m-1, CSB-E13693m-5, CSB-E13693m-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Mouse myeloperoxidase,MPO ELISA Kit

Catalog No.(s): CSB-E08723m-1, CSB-E08723m-5, CSB-E08723m-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Mouse Protein disulfide-isomerase(P4HB) ELISA kit

Catalog No.(s): CSB-EL017342MO-1, CSB-EL017342MO-5, CSB-EL017342MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Mouse Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-EL025270MO-1, CSB-EL025270MO-5, CSB-EL025270MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Nitric oxide synthase, endothelial (Nos3) partial, N-terminal 6xHis-tagged (E. coli-derived, recombinant rat)

Catalog No.(s): CSB-RP165794r(A3)-20, CSB-RP165794r(A3)-100, CSB-RP165794r(A3)-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Pig Myeloperoxidase (MPO) ELISA kit

Catalog No.(s): CSB-E09397p-1, CSB-E09397p-5, CSB-E09397p-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Rabbit Myeloperoxidase (MPO) ELISA kit

Catalog No.(s): CSB-E13689Rb-1, CSB-E13689Rb-5, CSB-E13689Rb-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Rat Metallothionein,MT ELISA Kit

Catalog No.(s): CSB-E11315r-1, CSB-E11315r-5, CSB-E11315r-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Rat Myeloperoxidase (MPO) ELISA kit

Catalog No.(s): CSB-E08722r-1, CSB-E08722r-5, CSB-E08722r-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Rat Prealbumin (PA) ELISA Kit

Catalog No.(s): CSB-E13251r-1, CSB-E13251r-5, CSB-E13251r-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Soluble Amyloid Precursor Protein Alpha (sAPPα) ELISA Kit (human)

Catalog No.(s): CSB-EQ027464HU-1, CSB-EQ027464HU-5, CSB-EQ027464HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

TAR DNA-binding protein 43 (TARDBP/TDP-43) ELISA Kit (human)

Catalog No.(s): CSB-E17007h-1, CSB-E17007h-5, CSB-E17007h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

TAR DNA-binding protein 43 (TDP-43/TARDBP) partial, N-terminal 6xHis-SUMO-tagged (E. coli-derived, recombinant human)

Catalog No.(s): CSB-EP023129HU-20, CSB-EP023129HU-100, CSB-EP023129HU-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

TAR DNA-binding protein 43 (TDP-43/TARDBP) partial, N-terminal 6xHis-tagged (yeast-derived, recombinant human)

Catalog No.(s): CSB-YP023129HU-20, CSB-YP023129HU-100, CSB-YP023129HU-500

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

TAR DNA-binding protein 43 (TDP-43/TARDBP) partial, N-terminal GST-tagged (E. coli-derived, recombinant human)

Catalog No.(s): CSB-EP023129HUe0-20, CSB-EP023129HUe0-100, CSB-EP023129HUe0-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...