Anti ZDHHC5 pAb (ATL-HPA014670)

Atlas Antibodies

Catalog No.: ATL-HPA014670-25

Protein Description: zinc finger, DHHC-type containing 5
Gene Name: ZDHHC5
Alternative Gene Name: KIAA1748, ZNF375
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034075: 95%, ENSRNOG00000006832: 96%
Entrez Gene ID: 25921
Uniprot ID: Q9C0B5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPE
• Gene Sequence: DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPE
• Gene ID - Mouse: ENSMUSG00000034075
• Gene ID - Rat: ENSRNOG00000006832
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZDHHC5 pAb (ATL-HPA014670) – 15 Found

Tian, Hui; Lu, Jui-Yun; Shao, Chunli; Huffman, Kenneth E; Carstens, Ryan M; Larsen, Jill E; Girard, Luc; Liu, Hui; Rodriguez-Canales, Jaime; Frenkel, Eugene P; Wistuba, Ignacio I; Minna, John D; Hofmann, Sandra L. Systematic siRNA Screen Unmasks NSCLC Growth Dependence by Palmitoyltransferase DHHC5. Molecular Cancer Research : Mcr. 2015;13(4):784-94. 

Collins, Mark O; Woodley, Keith T; Choudhary, Jyoti S. Global, site-specific analysis of neuronal protein S-acylation. Scientific Reports. 2017;7(1):4683. 

Sergeeva, Oksana A; van der Goot, F Gisou. Anthrax toxin requires ZDHHC5-mediated palmitoylation of its surface-processing host enzymes. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2019;116(4):1279-1288. 

Li, Yi; Hu, Jie; Höfer, Klemens; Wong, Andrew M S; Cooper, Jonathan D; Birnbaum, Shari G; Hammer, Robert E; Hofmann, Sandra L. DHHC5 interacts with PDZ domain 3 of post-synaptic density-95 (PSD-95) protein and plays a role in learning and memory. The Journal Of Biological Chemistry. 2010;285(17):13022-31. 

Li, Yi; Martin, Brent R; Cravatt, Benjamin F; Hofmann, Sandra L. DHHC5 protein palmitoylates flotillin-2 and is rapidly degraded on induction of neuronal differentiation in cultured cells. The Journal Of Biological Chemistry. 2012;287(1):523-530. 

Brigidi, G Stefano; Sun, Yu; Beccano-Kelly, Dayne; Pitman, Kimberley; Mobasser, Mahsan; Borgland, Stephanie L; Milnerwood, Austen J; Bamji, Shernaz X. Palmitoylation of δ-catenin by DHHC5 mediates activity-induced synapse plasticity. Nature Neuroscience. 2014;17(4):522-32. 

Brigidi, G Stefano; Santyr, Brendan; Shimell, Jordan; Jovellar, Blair; Bamji, Shernaz X. Activity-regulated trafficking of the palmitoyl-acyl transferase DHHC5. Nature Communications. 2015;6( 26334723):8200. 

Chopard, Christophe; Tong, Phuoc Bao Viet; Tóth, Petra; Schatz, Malvina; Yezid, Hocine; Debaisieux, Solène; Mettling, Clément; Gross, Antoine; Pugnière, Martine; Tu, Annie; Strub, Jean-Marc; Mesnard, Jean-Michel; Vitale, Nicolas; Beaumelle, Bruno. Cyclophilin A enables specific HIV-1 Tat palmitoylation and accumulation in uninfected cells. Nature Communications. 2018;9(1):2251. 

Hilgemann, Donald W; Lin, Mei-Jung; Fine, Michael; Deisl, Christine. On the existence of endocytosis driven by membrane phase separations. Biochimica Et Biophysica Acta. Biomembranes. 2020;1862(1):183007. 

Gök, Caglar; Plain, Fiona; Robertson, Alan D; Howie, Jacqueline; Baillie, George S; Fraser, Niall J; Fuller, William. Dynamic Palmitoylation of the Sodium-Calcium Exchanger Modulates Its Structure, Affinity for Lipid-Ordered Domains, and Inhibition by XIP. Cell Reports. 2020;31(10):107697. 

Plain, Fiona; Howie, Jacqueline; Kennedy, Jennifer; Brown, Elaine; Shattock, Michael J; Fraser, Niall J; Fuller, William. Control of protein palmitoylation by regulating substrate recruitment to a zDHHC-protein acyltransferase. Communications Biology. 2020;3(1):411. 

Hao, Jian-Wei; Wang, Juan; Guo, Huiling; Zhao, Yin-Yue; Sun, Hui-Hui; Li, Yi-Fan; Lai, Xiao-Ying; Zhao, Ning; Wang, Xu; Xie, Changchuan; Hong, Lixin; Huang, Xi; Wang, Hong-Rui; Li, Cheng-Bin; Liang, Bin; Chen, Shuai; Zhao, Tong-Jin. CD36 facilitates fatty acid uptake by dynamic palmitoylation-regulated endocytosis. Nature Communications. 2020;11(1):4765. 

Mekhail, Katrina; Lee, Minhyoung; Sugiyama, Michael; Astori, Audrey; St-Germain, Jonathan; Latreille, Elyse; Khosraviani, Negar; Wei, Kuiru; Li, Zhijie; Rini, James; Lee, Warren L; Antonescu, Costin; Raught, Brian; Fairn, Gregory D. FASN inhibitor TVB-3166 prevents S-acylation of the spike protein of human coronaviruses. Journal Of Lipid Research. 2022;63(9):100256. 

Main, Alice; Boguslavskyi, Andri; Howie, Jacqueline; Kuo, Chien-Wen; Rankin, Aileen; Burton, Francis L; Smith, Godfrey L; Hajjar, Roger; Baillie, George S; Campbell, Kenneth S; Shattock, Michael J; Fuller, William. Dynamic but discordant alterations in zDHHC5 expression and palmitoylation of its substrates in cardiac pathologies. Frontiers In Physiology. 13( 36277202):1023237. 

Shimell, Jordan J; Globa, Andrea; Sepers, Marja D; Wild, Angela R; Matin, Nusrat; Raymond, Lynn A; Bamji, Shernaz X. Regulation of hippocampal excitatory synapses by the Zdhhc5 palmitoyl acyltransferase. Journal Of Cell Science. 2021;134(9)