Anti ZBTB42 pAb (ATL-HPA000703)

Atlas Antibodies

Catalog No.: ATL-HPA000703-25

Protein Description: zinc finger and BTB domain containing 42
Gene Name: ZBTB42
Alternative Gene Name: ZNF925
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037638: 81%, ENSRNOG00000037562: 82%
Entrez Gene ID: 100128927
Uniprot ID: B2RXF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVRLNGDIVTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIVKVCKGRLQEKDRSLDPGNPAPGAEPAQPPC
• Gene Sequence: LGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVRLNGDIVTAPAFGRLLDFMYEGRLDLRSLPVEDVLAAASYLHMYDIVKVCKGRLQEKDRSLDPGNPAPGAEPAQPPC
• Gene ID - Mouse: ENSMUSG00000037638
• Gene ID - Rat: ENSRNOG00000037562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.