Anti YTHDC1 pAb (ATL-HPA036462)

Atlas Antibodies

Catalog No.: ATL-HPA036462-25

Protein Description: YTH domain containing 1
Gene Name: YTHDC1
Alternative Gene Name: KIAA1966, YT521, YT521-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035851: 93%, ENSRNOG00000001996: 92%
Entrez Gene ID: 91746
Uniprot ID: Q96MU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVD
• Gene Sequence: LVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVD
• Gene ID - Mouse: ENSMUSG00000035851
• Gene ID - Rat: ENSRNOG00000001996
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti YTHDC1 pAb (ATL-HPA036462) – 1 Found

Condic, Mateja; Thiesler, Thore; Staerk, Christian; Klümper, Niklas; Ellinger, Jörg; Egger, Eva K; Kübler, Kirsten; Kristiansen, Glen; Mustea, Alexander; Ralser, Damian J. N6-methyladenosine RNA modification (m6A) is of prognostic value in HPV-dependent vulvar squamous cell carcinoma. Bmc Cancer. 2022;22(1):943.