Anti VPS51 pAb (ATL-HPA039650)

Atlas Antibodies

Catalog No.: ATL-HPA039650-25

Protein Description: vacuolar protein sorting 51 homolog (S. cerevisiae)
Gene Name: VPS51
Alternative Gene Name: ANG2, ANG3, C11orf2, C11orf3, FFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024797: 99%, ENSRNOG00000020996: 99%
Entrez Gene ID: 738
Uniprot ID: Q9UID3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLATNMAVITDFS
• Gene Sequence: FDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLATNMAVITDFS
• Gene ID - Mouse: ENSMUSG00000024797
• Gene ID - Rat: ENSRNOG00000020996
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VPS51 pAb (ATL-HPA039650) – 3 Found

Gershlick, David C; Schindler, Christina; Chen, Yu; Bonifacino, Juan S. TSSC1 is novel component of the endosomal retrieval machinery. Molecular Biology Of The Cell. 2016;27(18):2867-78. 

Gershlick, David C; Ishida, Morié; Jones, Julie R; Bellomo, Allison; Bonifacino, Juan S; Everman, David B. A neurodevelopmental disorder caused by mutations in the VPS51 subunit of the GARP and EARP complexes. Human Molecular Genetics. 2019;28(9):1548-1560. 

Ishida, Morié; Bonifacino, Juan S. ARFRP1 functions upstream of ARL1 and ARL5 to coordinate recruitment of distinct tethering factors to the trans-Golgi network. The Journal Of Cell Biology. 2019;218(11):3681-3696.