Anti UPK2 pAb (ATL-HPA043312 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043312-25

Protein Description: uroplakin 2
Gene Name: UPK2
Alternative Gene Name: MGC138598, UP2, UPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041523: 95%, ENSRNOG00000043324: 95%
Entrez Gene ID: 7379
Uniprot ID: O00526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS
• Gene Sequence: ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS
• Gene ID - Mouse: ENSMUSG00000041523
• Gene ID - Rat: ENSRNOG00000043324
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UPK2 pAb (ATL-HPA043312 w/enhanced validation) – 1 Found

Garzón, Ingrid; Jaimes-Parra, Boris Damián; Pascual-Geler, Manrique; Cózar, José Manuel; Sánchez-Quevedo, María Del Carmen; Mosquera-Pacheco, María Auxiliadora; Sánchez-Montesinos, Indalecio; Fernández-Valadés, Ricardo; Campos, Fernando; Alaminos, Miguel. Biofabrication of a Tubular Model of Human Urothelial Mucosa Using Human Wharton Jelly Mesenchymal Stromal Cells. Polymers. 2021;13(10)