Anti TOX pAb (ATL-HPA018322 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018322-25

Protein Description: thymocyte selection-associated high mobility group box
Gene Name: TOX
Alternative Gene Name: KIAA0808, TOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041272: 98%, ENSRNOG00000010777: 98%
Entrez Gene ID: 9760
Uniprot ID: O94900
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQN
• Gene Sequence: PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQN
• Gene ID - Mouse: ENSMUSG00000041272
• Gene ID - Rat: ENSRNOG00000010777
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TOX pAb (ATL-HPA018322 w/enhanced validation) – 5 Found

Schrader, Anne M R; Jansen, Patty M; Willemze, Rein. TOX expression in cutaneous B-cell lymphomas. Archives Of Dermatological Research. 2016;308(6):423-7. 

McGirt, L Y; Degesys, C A; Johnson, V E; Zic, J A; Zwerner, J P; Eischen, C M. TOX expression and role in CTCL. Journal Of The European Academy Of Dermatology And Venereology : Jeadv. 2016;30(9):1497-502. 

McGirt, Laura Y; Adams, Clare M; Baerenwald, Devin A; Zwerner, Jeffrey P; Zic, John A; Eischen, Christine M. miR-223 regulates cell growth and targets proto-oncogenes in mycosis fungoides/cutaneous T-cell lymphoma. The Journal Of Investigative Dermatology. 2014;134(4):1101-1107. 

Xu, Jingkai; Huang, He; Wang, Shangshang; Chen, Yanzhen; Yin, Xueli; Zhang, Xuejun; Zhang, Yaohua. Molecular profiling of TOX-deficient neoplastic cells in cutaneous T cell lymphoma. Archives Of Dermatological Research. 2020;312(7):513-525. 

Boki, Hikari; Miyagaki, Tomomitsu; Shono, Yuki; Kamijo, Hiroaki; Oka, Tomonori; Suga, Hiraku; Asano, Yoshihide; Sugaya, Makoto; Sato, Shinichi. Increased Expression of Delta-like Ligand 4 in Mycosis Fungoides. Acta Dermato-Venereologica. 2020;100(4):adv00059.