Anti TNRC6A pAb (ATL-HPA017869)

Atlas Antibodies

Catalog No.: ATL-HPA017869-25

Protein Description: trinucleotide repeat containing 6A
Gene Name: TNRC6A
Alternative Gene Name: CAGH26, GW182, KIAA1460, TNRC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052707: 95%, ENSRNOG00000024737: 95%
Entrez Gene ID: 27327
Uniprot ID: Q8NDV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLQRLLAQQQRAQSQRSVPSGNRPQQDQQGRPLSVQQQMMQQSRQLDPNLLVKQQTPPSQQQPLHQPAMKSFLDNVMPHTTPELQKGPSPINAFSNFPIGLNSNLNVNMDMNSIKEPQSRLRKWT
• Gene Sequence: QLQRLLAQQQRAQSQRSVPSGNRPQQDQQGRPLSVQQQMMQQSRQLDPNLLVKQQTPPSQQQPLHQPAMKSFLDNVMPHTTPELQKGPSPINAFSNFPIGLNSNLNVNMDMNSIKEPQSRLRKWT
• Gene ID - Mouse: ENSMUSG00000052707
• Gene ID - Rat: ENSRNOG00000024737
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TNRC6A pAb (ATL-HPA017869) – 1 Found

Li, Liang; Chen, Qiang; Feng, Chao; Jin, Yongping; Xia, Shudong. Aberrant expression of TNRC6a and miR-21 during myocardial infarction. 3 Biotech. 2019;9(7):285.