Anti TMTC4 pAb (ATL-HPA016489)

Atlas Antibodies

Catalog No.:
ATL-HPA016489-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane and tetratricopeptide repeat containing 4
Gene Name: TMTC4
Alternative Gene Name: FLJ14624, FLJ22153
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041594: 96%, ENSRNOG00000014310: 94%
Entrez Gene ID: 84899
Uniprot ID: Q5T4D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLR
Gene Sequence NLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLR
Gene ID - Mouse ENSMUSG00000041594
Gene ID - Rat ENSRNOG00000014310
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TMTC4 pAb (ATL-HPA016489)
Datasheet Anti TMTC4 pAb (ATL-HPA016489) Datasheet (External Link)
Vendor Page Anti TMTC4 pAb (ATL-HPA016489) at Atlas Antibodies

Documents & Links for Anti TMTC4 pAb (ATL-HPA016489)
Datasheet Anti TMTC4 pAb (ATL-HPA016489) Datasheet (External Link)
Vendor Page Anti TMTC4 pAb (ATL-HPA016489)
Citations for Anti TMTC4 pAb (ATL-HPA016489) – 1 Found
Li, Jiang; Akil, Omar; Rouse, Stephanie L; McLaughlin, Conor W; Matthews, Ian R; Lustig, Lawrence R; Chan, Dylan K; Sherr, Elliott H. Deletion of Tmtc4 activates the unfolded protein response and causes postnatal hearing loss. The Journal Of Clinical Investigation. 2018;128(11):5150-5162.  PubMed