Anti TIA1 pAb (ATL-HPA056961)

Atlas Antibodies

Catalog No.:
ATL-HPA056961-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: TIA1 cytotoxic granule-associated RNA binding protein
Gene Name: TIA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071337: 88%, ENSRNOG00000016813: 88%
Entrez Gene ID: 7072
Uniprot ID: P31483
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRV
Gene Sequence NQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRV
Gene ID - Mouse ENSMUSG00000071337
Gene ID - Rat ENSRNOG00000016813
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIA1 pAb (ATL-HPA056961)
Datasheet Anti TIA1 pAb (ATL-HPA056961) Datasheet (External Link)
Vendor Page Anti TIA1 pAb (ATL-HPA056961) at Atlas Antibodies

Documents & Links for Anti TIA1 pAb (ATL-HPA056961)
Datasheet Anti TIA1 pAb (ATL-HPA056961) Datasheet (External Link)
Vendor Page Anti TIA1 pAb (ATL-HPA056961)