Anti TGFBR3 pAb (ATL-HPA008257)

Atlas Antibodies

Catalog No.: ATL-HPA008257-25

Protein Description: transforming growth factor, beta receptor III
Gene Name: TGFBR3
Alternative Gene Name: betaglycan, BGCAN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029287: 78%, ENSRNOG00000002093: 78%
Entrez Gene ID: 7049
Uniprot ID: Q03167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLF
• Gene Sequence: GYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLF
• Gene ID - Mouse: ENSMUSG00000029287
• Gene ID - Rat: ENSRNOG00000002093
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TGFBR3 pAb (ATL-HPA008257) – 4 Found

Dalin, Martin G; Katabi, Nora; Persson, Marta; Lee, Ken-Wing; Makarov, Vladimir; Desrichard, Alexis; Walsh, Logan A; West, Lyndsay; Nadeem, Zaineb; Ramaswami, Deepa; Havel, Jonathan J; Kuo, Fengshen; Chadalavada, Kalyani; Nanjangud, Gouri J; Ganly, Ian; Riaz, Nadeem; Ho, Alan L; Antonescu, Cristina R; Ghossein, Ronald; Stenman, Göran; Chan, Timothy A; Morris, Luc G T. Multi-dimensional genomic analysis of myoepithelial carcinoma identifies prevalent oncogenic gene fusions. Nature Communications. 2017;8(1):1197. 

Bajikar, Sameer S; Wang, Chun-Chao; Borten, Michael A; Pereira, Elizabeth J; Atkins, Kristen A; Janes, Kevin A. Tumor-Suppressor Inactivation of GDF11 Occurs by Precursor Sequestration in Triple-Negative Breast Cancer. Developmental Cell. 2017;43(4):418-435.e13. 

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. 

Wang, Chun-Chao; Bajikar, Sameer S; Jamal, Leen; Atkins, Kristen A; Janes, Kevin A. A time- and matrix-dependent TGFBR3-JUND-KRT5 regulatory circuit in single breast epithelial cells and basal-like premalignancies. Nature Cell Biology. 2014;16(4):345-56.