Anti TBX6 pAb (ATL-HPA062498)

Atlas Antibodies

Catalog No.:
ATL-HPA062498-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: T-box 6
Gene Name: TBX6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030699: 94%, ENSRNOG00000019771: 94%
Entrez Gene ID: 6911
Uniprot ID: O95947
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFIS
Gene Sequence HKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFIS
Gene ID - Mouse ENSMUSG00000030699
Gene ID - Rat ENSRNOG00000019771
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBX6 pAb (ATL-HPA062498)
Datasheet Anti TBX6 pAb (ATL-HPA062498) Datasheet (External Link)
Vendor Page Anti TBX6 pAb (ATL-HPA062498) at Atlas Antibodies

Documents & Links for Anti TBX6 pAb (ATL-HPA062498)
Datasheet Anti TBX6 pAb (ATL-HPA062498) Datasheet (External Link)
Vendor Page Anti TBX6 pAb (ATL-HPA062498)