Anti TBCEL pAb (ATL-HPA038593)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038593-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TBCEL
Alternative Gene Name: LRRC35, MGC10233
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037287: 97%, ENSRNOG00000032364: 98%
Entrez Gene ID: 219899
Uniprot ID: Q5QJ74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVP |
Gene Sequence | QPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVP |
Gene ID - Mouse | ENSMUSG00000037287 |
Gene ID - Rat | ENSRNOG00000032364 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TBCEL pAb (ATL-HPA038593) | |
Datasheet | Anti TBCEL pAb (ATL-HPA038593) Datasheet (External Link) |
Vendor Page | Anti TBCEL pAb (ATL-HPA038593) at Atlas Antibodies |
Documents & Links for Anti TBCEL pAb (ATL-HPA038593) | |
Datasheet | Anti TBCEL pAb (ATL-HPA038593) Datasheet (External Link) |
Vendor Page | Anti TBCEL pAb (ATL-HPA038593) |