Anti STXBP3 pAb (ATL-HPA027225)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027225-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: STXBP3
Alternative Gene Name: UNC-18C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027882: 91%, ENSRNOG00000020392: 88%
Entrez Gene ID: 6814
Uniprot ID: O00186
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLF |
Gene Sequence | FDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLF |
Gene ID - Mouse | ENSMUSG00000027882 |
Gene ID - Rat | ENSRNOG00000020392 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti STXBP3 pAb (ATL-HPA027225) | |
Datasheet | Anti STXBP3 pAb (ATL-HPA027225) Datasheet (External Link) |
Vendor Page | Anti STXBP3 pAb (ATL-HPA027225) at Atlas Antibodies |
Documents & Links for Anti STXBP3 pAb (ATL-HPA027225) | |
Datasheet | Anti STXBP3 pAb (ATL-HPA027225) Datasheet (External Link) |
Vendor Page | Anti STXBP3 pAb (ATL-HPA027225) |