Anti STK38L pAb (ATL-HPA038623)

Atlas Antibodies

Catalog No.:
ATL-HPA038623-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: serine/threonine kinase 38 like
Gene Name: STK38L
Alternative Gene Name: KIAA0965, NDR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024006: 95%, ENSRNOG00000000519: 95%
Entrez Gene ID: 23012
Uniprot ID: Q9Y2H1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDL
Gene Sequence STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDL
Gene ID - Mouse ENSMUSG00000024006
Gene ID - Rat ENSRNOG00000000519
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STK38L pAb (ATL-HPA038623)
Datasheet Anti STK38L pAb (ATL-HPA038623) Datasheet (External Link)
Vendor Page Anti STK38L pAb (ATL-HPA038623) at Atlas Antibodies

Documents & Links for Anti STK38L pAb (ATL-HPA038623)
Datasheet Anti STK38L pAb (ATL-HPA038623) Datasheet (External Link)
Vendor Page Anti STK38L pAb (ATL-HPA038623)