Anti STK36 pAb (ATL-HPA027453)

Atlas Antibodies

Catalog No.: ATL-HPA027453-25

Protein Description: serine/threonine kinase 36
Gene Name: STK36
Alternative Gene Name: FU, KIAA1278
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033276: 82%, ENSRNOG00000016913: 84%
Entrez Gene ID: 27148
Uniprot ID: Q9NRP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EMWTVLWHRFSMVLRLPEEASAQEGELSLSSPPSPEPDWTLISPQGMAALLSLAMATFTQEPQLCLSCLSQHGSILMSILKH
• Gene Sequence: EMWTVLWHRFSMVLRLPEEASAQEGELSLSSPPSPEPDWTLISPQGMAALLSLAMATFTQEPQLCLSCLSQHGSILMSILKH
• Gene ID - Mouse: ENSMUSG00000033276
• Gene ID - Rat: ENSRNOG00000016913
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.