Anti SSBP1 pAb (ATL-HPA002866 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002866-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: single-stranded DNA binding protein 1, mitochondrial
Gene Name: SSBP1
Alternative Gene Name: mtSSB, SSBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029911: 92%, ENSRNOG00000012100: 89%
Entrez Gene ID: 6742
Uniprot ID: Q04837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE
Gene Sequence LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE
Gene ID - Mouse ENSMUSG00000029911
Gene ID - Rat ENSRNOG00000012100
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SSBP1 pAb (ATL-HPA002866 w/enhanced validation)
Datasheet Anti SSBP1 pAb (ATL-HPA002866 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SSBP1 pAb (ATL-HPA002866 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SSBP1 pAb (ATL-HPA002866 w/enhanced validation)
Datasheet Anti SSBP1 pAb (ATL-HPA002866 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SSBP1 pAb (ATL-HPA002866 w/enhanced validation)
Citations for Anti SSBP1 pAb (ATL-HPA002866 w/enhanced validation) – 11 Found
Hensen, Fenna; Moretton, Amandine; van Esveld, Selma; Farge, Géraldine; Spelbrink, Johannes N. The mitochondrial outer-membrane location of the EXD2 exonuclease contradicts its direct role in nuclear DNA repair. Scientific Reports. 2018;8(1):5368.  PubMed
Kauppila, Johanna H K; Bonekamp, Nina A; Mourier, Arnaud; Isokallio, Marita A; Just, Alexandra; Kauppila, Timo E S; Stewart, James B; Larsson, Nils-Göran. Base-excision repair deficiency alone or combined with increased oxidative stress does not increase mtDNA point mutations in mice. Nucleic Acids Research. 2018;46(13):6642-6669.  PubMed
Nair, Remya R; Koivisto, Henna; Jokivarsi, Kimmo; Miinalainen, Ilkka J; Autio, Kaija J; Manninen, Aki; Poutiainen, Pekka; Tanila, Heikki; Hiltunen, J Kalervo; Kastaniotis, Alexander J. Impaired Mitochondrial Fatty Acid Synthesis Leads to Neurodegeneration in Mice. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2018;38(45):9781-9800.  PubMed
Jonsson, Marte; Fjeldbo, Christina Sæten; Holm, Ruth; Stokke, Trond; Kristensen, Gunnar Balle; Lyng, Heidi. Mitochondrial Function of CKS2 Oncoprotein Links Oxidative Phosphorylation with Cell Division in Chemoradioresistant Cervical Cancer. Neoplasia (New York, N.y.). 2019;21(4):353-362.  PubMed
Silva Ramos, Eduardo; Motori, Elisa; Brüser, Christian; Kühl, Inge; Yeroslaviz, Assa; Ruzzenente, Benedetta; Kauppila, Johanna H K; Busch, Jakob D; Hultenby, Kjell; Habermann, Bianca H; Jakobs, Stefan; Larsson, Nils-Göran; Mourier, Arnaud. Mitochondrial fusion is required for regulation of mitochondrial DNA replication. Plos Genetics. 2019;15(6):e1008085.  PubMed
Sidarala, Vaibhav; Zhu, Jie; Levi-D'Ancona, Elena; Pearson, Gemma L; Reck, Emma C; Walker, Emily M; Kaufman, Brett A; Soleimanpour, Scott A. Mitofusin 1 and 2 regulation of mitochondrial DNA content is a critical determinant of glucose homeostasis. Nature Communications. 2022;13(1):2340.  PubMed
Nicolas, Armel; Alazard-Dany, Nathalie; Biollay, Coline; Arata, Loredana; Jolinon, Nelly; Kuhn, Lauriane; Ferro, Myriam; Weller, Sandra K; Epstein, Alberto L; Salvetti, Anna; Greco, Anna. Identification of rep-associated factors in herpes simplex virus type 1-induced adeno-associated virus type 2 replication compartments. Journal Of Virology. 2010;84(17):8871-87.  PubMed
Rajala, Nina; Hensen, Fenna; Wessels, Hans J C T; Ives, Daniel; Gloerich, Jolein; Spelbrink, Johannes N. Whole cell formaldehyde cross-linking simplifies purification of mitochondrial nucleoids and associated proteins involved in mitochondrial gene expression. Plos One. 10(2):e0116726.  PubMed
Hensen, Fenna; Potter, Alisa; van Esveld, Selma L; Tarrés-Solé, Aleix; Chakraborty, Arka; Solà, Maria; Spelbrink, Johannes N. Mitochondrial RNA granules are critically dependent on mtDNA replication factors Twinkle and mtSSB. Nucleic Acids Research. 2019;47(7):3680-3698.  PubMed
Piro-Mégy, Camille; Sarzi, Emmanuelle; Tarrés-Solé, Aleix; Péquignot, Marie; Hensen, Fenna; Quilès, Mélanie; Manes, Gaël; Chakraborty, Arka; Sénéchal, Audrey; Bocquet, Béatrice; Cazevieille, Chantal; Roubertie, Agathe; Müller, Agnès; Charif, Majida; Goudenège, David; Lenaers, Guy; Wilhelm, Helmut; Kellner, Ulrich; Weisschuh, Nicole; Wissinger, Bernd; Zanlonghi, Xavier; Hamel, Christian; Spelbrink, Johannes N; Sola, Maria; Delettre, Cécile. Dominant mutations in mtDNA maintenance gene SSBP1 cause optic atrophy and foveopathy. The Journal Of Clinical Investigation. 2020;130(1):143-156.  PubMed
Bajzikova, Martina; Kovarova, Jaromira; Coelho, Ana R; Boukalova, Stepana; Oh, Sehyun; Rohlenova, Katerina; Svec, David; Hubackova, Sona; Endaya, Berwini; Judasova, Kristyna; Bezawork-Geleta, Ayenachew; Kluckova, Katarina; Chatre, Laurent; Zobalova, Renata; Novakova, Anna; Vanova, Katerina; Ezrova, Zuzana; Maghzal, Ghassan J; Magalhaes Novais, Silvia; Olsinova, Marie; Krobova, Linda; An, Yong Jin; Davidova, Eliska; Nahacka, Zuzana; Sobol, Margarita; Cunha-Oliveira, Teresa; Sandoval-Acuña, Cristian; Strnad, Hynek; Zhang, Tongchuan; Huynh, Thanh; Serafim, Teresa L; Hozak, Pavel; Sardao, Vilma A; Koopman, Werner J H; Ricchetti, Miria; Oliveira, Paulo J; Kolar, Frantisek; Kubista, Mikael; Truksa, Jaroslav; Dvorakova-Hortova, Katerina; Pacak, Karel; Gurlich, Robert; Stocker, Roland; Zhou, Yaoqi; Berridge, Michael V; Park, Sunghyouk; Dong, Lanfeng; Rohlena, Jakub; Neuzil, Jiri. Reactivation of Dihydroorotate Dehydrogenase-Driven Pyrimidine Biosynthesis Restores Tumor Growth of Respiration-Deficient Cancer Cells. Cell Metabolism. 2019;29(2):399-416.e10.  PubMed