Anti SRP19 pAb (ATL-HPA029272)

Atlas Antibodies

Catalog No.: ATL-HPA029272-100

Protein Description: signal recognition particle 19kDa
Gene Name: SRP19
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014504: 98%, ENSRNOG00000020204: 97%
Entrez Gene ID: 6728
Uniprot ID: P09132
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNR
• Gene Sequence: DQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNR
• Gene ID - Mouse: ENSMUSG00000014504
• Gene ID - Rat: ENSRNOG00000020204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.