Anti SOGA3 pAb (ATL-HPA035388)

Atlas Antibodies

Catalog No.: ATL-HPA035388-25

Protein Description: SOGA family member 3
Gene Name: SOGA3
Alternative Gene Name: C6orf174, dJ403A15.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038916: 97%, ENSRNOG00000012324: 99%
Entrez Gene ID:
Uniprot ID: Q5TF21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRITAELNKYKYKS
• Gene Sequence: ELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRITAELNKYKYKS
• Gene ID - Mouse: ENSMUSG00000038916
• Gene ID - Rat: ENSRNOG00000012324
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.