Anti SNTN pAb (ATL-HPA058399 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA058399-25

Protein Description: sentan, cilia apical structure protein
Gene Name: SNTN
Alternative Gene Name: FLJ44379, S100AL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044772: 77%, ENSRNOG00000027383: 78%
Entrez Gene ID: 132203
Uniprot ID: A6NMZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITVMSDLLQ
• Gene Sequence: KAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITVMSDLLQ
• Gene ID - Mouse: ENSMUSG00000044772
• Gene ID - Rat: ENSRNOG00000027383
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.