Anti SLC38A9 pAb (ATL-HPA043785)

Atlas Antibodies

Catalog No.: ATL-HPA043785-25

Protein Description: solute carrier family 38, member 9
Gene Name: SLC38A9
Alternative Gene Name: FLJ90709
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047789: 88%, ENSRNOG00000009851: 88%
Entrez Gene ID: 153129
Uniprot ID: Q8NBW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAY
• Gene Sequence: NSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAY
• Gene ID - Mouse: ENSMUSG00000047789
• Gene ID - Rat: ENSRNOG00000009851
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC38A9 pAb (ATL-HPA043785) – 7 Found

Hellsten, Sofie V; Eriksson, Mikaela M; Lekholm, Emilia; Arapi, Vasiliki; Perland, Emelie; Fredriksson, Robert. The gene expression of the neuronal protein, SLC38A9, changes in mouse brain after in vivo starvation and high-fat diet. Plos One. 12(2):e0172917. 

Jia, Jingyue; Abudu, Yakubu Princely; Claude-Taupin, Aurore; Gu, Yuexi; Kumar, Suresh; Choi, Seong Won; Peters, Ryan; Mudd, Michal H; Allers, Lee; Salemi, Michelle; Phinney, Brett; Johansen, Terje; Deretic, Vojo. Galectins Control mTOR in Response to Endomembrane Damage. Molecular Cell. 2018;70(1):120-135.e8. 

Heinz, Leonhard X; Lee, JangEun; Kapoor, Utkarsh; Kartnig, Felix; Sedlyarov, Vitaly; Papakostas, Konstantinos; César-Razquin, Adrian; Essletzbichler, Patrick; Goldmann, Ulrich; Stefanovic, Adrijana; Bigenzahn, Johannes W; Scorzoni, Stefania; Pizzagalli, Mattia D; Bensimon, Ariel; Müller, André C; King, F James; Li, Jun; Girardi, Enrico; Mbow, M Lamine; Whitehurst, Charles E; Rebsamen, Manuele; Superti-Furga, Giulio. TASL is the SLC15A4-associated adaptor for IRF5 activation by TLR7-9. Nature. 2020;581(7808):316-322. 

Rebsamen, Manuele; Pochini, Lorena; Stasyk, Taras; de Araújo, Mariana E G; Galluccio, Michele; Kandasamy, Richard K; Snijder, Berend; Fauster, Astrid; Rudashevskaya, Elena L; Bruckner, Manuela; Scorzoni, Stefania; Filipek, Przemyslaw A; Huber, Kilian V M; Bigenzahn, Johannes W; Heinz, Leonhard X; Kraft, Claudine; Bennett, Keiryn L; Indiveri, Cesare; Huber, Lukas A; Superti-Furga, Giulio. SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1. Nature. 2015;519(7544):477-81. 

Jung, Jennifer; Genau, Heide Marika; Behrends, Christian. Amino Acid-Dependent mTORC1 Regulation by the Lysosomal Membrane Protein SLC38A9. Molecular And Cellular Biology. 2015;35(14):2479-94. 

Nnah, Israel C; Wang, Biao; Saqcena, Chaitali; Weber, Gregory F; Bonder, Edward M; Bagley, Dustin; De Cegli, Rossella; Napolitano, Gennaro; Medina, Diego L; Ballabio, Andrea; Dobrowolski, Radek. TFEB-driven endocytosis coordinates MTORC1 signaling and autophagy. Autophagy. 2019;15(1):151-164. 

Hirose, Shuuhei; Waku, Tsuyoshi; Tani, Misato; Masuda, Haruka; Endo, Keiko; Ashitani, Sanae; Aketa, Iori; Kitano, Hina; Nakada, Sota; Wada, Ayaka; Hatanaka, Atsushi; Osawa, Tsuyoshi; Soga, Tomoyoshi; Kobayashi, Akira. NRF3 activates mTORC1 arginine-dependently for cancer cell viability. Iscience. 2023;26(2):106045.