Anti SLC35B2 pAb (ATL-HPA029638)

Atlas Antibodies

Catalog No.: ATL-HPA029638-25

Protein Description: solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
Gene Name: SLC35B2
Alternative Gene Name: UGTrel4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037089: 89%, ENSRNOG00000019900: 91%
Entrez Gene ID: 347734
Uniprot ID: Q8TB61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
• Gene Sequence: FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
• Gene ID - Mouse: ENSMUSG00000037089
• Gene ID - Rat: ENSRNOG00000019900
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.