Anti SLC35B2 pAb (ATL-HPA029638)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029638-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SLC35B2
Alternative Gene Name: UGTrel4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037089: 89%, ENSRNOG00000019900: 91%
Entrez Gene ID: 347734
Uniprot ID: Q8TB61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT |
Gene Sequence | FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT |
Gene ID - Mouse | ENSMUSG00000037089 |
Gene ID - Rat | ENSRNOG00000019900 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC35B2 pAb (ATL-HPA029638) | |
Datasheet | Anti SLC35B2 pAb (ATL-HPA029638) Datasheet (External Link) |
Vendor Page | Anti SLC35B2 pAb (ATL-HPA029638) at Atlas Antibodies |
Documents & Links for Anti SLC35B2 pAb (ATL-HPA029638) | |
Datasheet | Anti SLC35B2 pAb (ATL-HPA029638) Datasheet (External Link) |
Vendor Page | Anti SLC35B2 pAb (ATL-HPA029638) |