Anti SLC2A12 pAb (ATL-HPA031593)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031593-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SLC2A12
Alternative Gene Name: GLUT12, GLUT8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037490: 87%, ENSRNOG00000011161: 87%
Entrez Gene ID: 154091
Uniprot ID: Q8TD20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTR |
Gene Sequence | PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTR |
Gene ID - Mouse | ENSMUSG00000037490 |
Gene ID - Rat | ENSRNOG00000011161 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC2A12 pAb (ATL-HPA031593) | |
Datasheet | Anti SLC2A12 pAb (ATL-HPA031593) Datasheet (External Link) |
Vendor Page | Anti SLC2A12 pAb (ATL-HPA031593) at Atlas Antibodies |
Documents & Links for Anti SLC2A12 pAb (ATL-HPA031593) | |
Datasheet | Anti SLC2A12 pAb (ATL-HPA031593) Datasheet (External Link) |
Vendor Page | Anti SLC2A12 pAb (ATL-HPA031593) |