Anti SLC2A12 pAb (ATL-HPA031593)

Atlas Antibodies

Catalog No.: ATL-HPA031593-25

Protein Description: solute carrier family 2 (facilitated glucose transporter), member 12
Gene Name: SLC2A12
Alternative Gene Name: GLUT12, GLUT8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037490: 87%, ENSRNOG00000011161: 87%
Entrez Gene ID: 154091
Uniprot ID: Q8TD20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTR
• Gene Sequence: PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTR
• Gene ID - Mouse: ENSMUSG00000037490
• Gene ID - Rat: ENSRNOG00000011161
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.