Anti SLC25A10 pAb (ATL-HPA023048)

Atlas Antibodies

Catalog No.:
ATL-HPA023048-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10
Gene Name: SLC25A10
Alternative Gene Name: DIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025792: 80%, ENSRNOG00000036693: 80%
Entrez Gene ID: 1468
Uniprot ID: Q9UBX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL
Gene Sequence SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL
Gene ID - Mouse ENSMUSG00000025792
Gene ID - Rat ENSRNOG00000036693
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC25A10 pAb (ATL-HPA023048)
Datasheet Anti SLC25A10 pAb (ATL-HPA023048) Datasheet (External Link)
Vendor Page Anti SLC25A10 pAb (ATL-HPA023048) at Atlas Antibodies

Documents & Links for Anti SLC25A10 pAb (ATL-HPA023048)
Datasheet Anti SLC25A10 pAb (ATL-HPA023048) Datasheet (External Link)
Vendor Page Anti SLC25A10 pAb (ATL-HPA023048)
Citations for Anti SLC25A10 pAb (ATL-HPA023048) – 1 Found
Indacochea, Alberto; Guerrero, Santiago; Ureña, Macarena; Araujo, Ferrán; Coll, Olga; LLeonart, Matilde E; Gebauer, Fátima. Cold-inducible RNA binding protein promotes breast cancer cell malignancy by regulating Cystatin C levels. Rna (New York, N.y.). 2021;27(2):190-201.  PubMed