Anti SLC25A10 pAb (ATL-HPA023048)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023048-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SLC25A10
Alternative Gene Name: DIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025792: 80%, ENSRNOG00000036693: 80%
Entrez Gene ID: 1468
Uniprot ID: Q9UBX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL |
Gene Sequence | SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL |
Gene ID - Mouse | ENSMUSG00000025792 |
Gene ID - Rat | ENSRNOG00000036693 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC25A10 pAb (ATL-HPA023048) | |
Datasheet | Anti SLC25A10 pAb (ATL-HPA023048) Datasheet (External Link) |
Vendor Page | Anti SLC25A10 pAb (ATL-HPA023048) at Atlas Antibodies |
Documents & Links for Anti SLC25A10 pAb (ATL-HPA023048) | |
Datasheet | Anti SLC25A10 pAb (ATL-HPA023048) Datasheet (External Link) |
Vendor Page | Anti SLC25A10 pAb (ATL-HPA023048) |
Citations for Anti SLC25A10 pAb (ATL-HPA023048) – 1 Found |
Indacochea, Alberto; Guerrero, Santiago; Ureña, Macarena; Araujo, Ferrán; Coll, Olga; LLeonart, Matilde E; Gebauer, Fátima. Cold-inducible RNA binding protein promotes breast cancer cell malignancy by regulating Cystatin C levels. Rna (New York, N.y.). 2021;27(2):190-201. PubMed |