Anti SLC22A11 pAb (ATL-HPA026076)

Atlas Antibodies

Catalog No.: ATL-HPA026076-25

Protein Description: solute carrier family 22 (organic anion/urate transporter), member 11
Gene Name: SLC22A11
Alternative Gene Name: OAT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052562: 50%, ENSRNOG00000004958: 52%
Entrez Gene ID: 55867
Uniprot ID: Q9NSA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RWLIIKGKPDQALQELRKVARINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPV
• Gene Sequence: RWLIIKGKPDQALQELRKVARINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPV
• Gene ID - Mouse: ENSMUSG00000052562
• Gene ID - Rat: ENSRNOG00000004958
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.