Anti SIX5 pAb (ATL-HPA042068)

Atlas Antibodies

Catalog No.:
ATL-HPA042068-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SIX homeobox 5
Gene Name: SIX5
Alternative Gene Name: DMAHP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040841: 97%, ENSRNOG00000060146: 90%
Entrez Gene ID: 147912
Uniprot ID: Q8N196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVPTSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVAVQQGKIILTATFPTSMLVSQVLP
Gene Sequence VVPTSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVAVQQGKIILTATFPTSMLVSQVLP
Gene ID - Mouse ENSMUSG00000040841
Gene ID - Rat ENSRNOG00000060146
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIX5 pAb (ATL-HPA042068)
Datasheet Anti SIX5 pAb (ATL-HPA042068) Datasheet (External Link)
Vendor Page Anti SIX5 pAb (ATL-HPA042068) at Atlas Antibodies

Documents & Links for Anti SIX5 pAb (ATL-HPA042068)
Datasheet Anti SIX5 pAb (ATL-HPA042068) Datasheet (External Link)
Vendor Page Anti SIX5 pAb (ATL-HPA042068)