Anti SERPINB2 pAb (ATL-HPA015480)

Atlas Antibodies

Catalog No.: ATL-HPA015480-25

Protein Description: serpin peptidase inhibitor, clade B (ovalbumin), member 2
Gene Name: SERPINB2
Alternative Gene Name: HsT1201, PAI2, PLANH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062345: 80%, ENSRNOG00000002460: 77%
Entrez Gene ID: 5055
Uniprot ID: P05120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKD
• Gene Sequence: TQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKD
• Gene ID - Mouse: ENSMUSG00000062345
• Gene ID - Rat: ENSRNOG00000002460
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SERPINB2 pAb (ATL-HPA015480) – 4 Found

Majoros, Hajnalka; Ujfaludi, Zsuzsanna; Borsos, Barbara Nikolett; Hudacsek, Viktória Vivien; Nagy, Zita; Coin, Frederic; Buzas, Krisztina; Kovács, Ilona; Bíró, Tamás; Boros, Imre Miklós; Pankotai, Tibor. SerpinB2 is involved in cellular response upon UV irradiation. Scientific Reports. 2019;9(1):2753. 

Castello-Cros, Remedios; Bonuccelli, Gloria; Molchansky, Alex; Capozza, Franco; Witkiewicz, Agnieszka K; Birbe, Ruth C; Howell, Anthony; Pestell, Richard G; Whitaker-Menezes, Diana; Sotgia, Federica; Lisanti, Michael P. Matrix remodeling stimulates stromal autophagy, "fueling" cancer cell mitochondrial metabolism and metastasis. Cell Cycle (Georgetown, Tex.). 2011;10(12):2021-34. 

Poaty, Henriette; Coullin, Philippe; Peko, Jean Félix; Dessen, Philippe; Diatta, Ange Lucien; Valent, Alexander; Leguern, Eric; Prévot, Sophie; Gombé-Mbalawa, Charles; Candelier, Jean-Jacques; Picard, Jean-Yves; Bernheim, Alain. Genome-wide high-resolution aCGH analysis of gestational choriocarcinomas. Plos One. 7(1):e29426. 

Lindskog, Cecilia; Korsgren, Olle; Pontén, Fredrik; Eriksson, Jan W; Johansson, Lars; Danielsson, Angelika. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. Journal Of Proteomics. 2012;75(9):2611-20.