Anti SDS pAb (ATL-HPA039230)

Atlas Antibodies

Catalog No.:
ATL-HPA039230-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: serine dehydratase
Gene Name: SDS
Alternative Gene Name: SDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029597: 86%, ENSRNOG00000001388: 89%
Entrez Gene ID: 10993
Uniprot ID: P20132
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKE
Gene Sequence PATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKE
Gene ID - Mouse ENSMUSG00000029597
Gene ID - Rat ENSRNOG00000001388
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SDS pAb (ATL-HPA039230)
Datasheet Anti SDS pAb (ATL-HPA039230) Datasheet (External Link)
Vendor Page Anti SDS pAb (ATL-HPA039230) at Atlas Antibodies

Documents & Links for Anti SDS pAb (ATL-HPA039230)
Datasheet Anti SDS pAb (ATL-HPA039230) Datasheet (External Link)
Vendor Page Anti SDS pAb (ATL-HPA039230)