Anti SDS pAb (ATL-HPA039230)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039230-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SDS
Alternative Gene Name: SDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029597: 86%, ENSRNOG00000001388: 89%
Entrez Gene ID: 10993
Uniprot ID: P20132
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKE |
Gene Sequence | PATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKE |
Gene ID - Mouse | ENSMUSG00000029597 |
Gene ID - Rat | ENSRNOG00000001388 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SDS pAb (ATL-HPA039230) | |
Datasheet | Anti SDS pAb (ATL-HPA039230) Datasheet (External Link) |
Vendor Page | Anti SDS pAb (ATL-HPA039230) at Atlas Antibodies |
Documents & Links for Anti SDS pAb (ATL-HPA039230) | |
Datasheet | Anti SDS pAb (ATL-HPA039230) Datasheet (External Link) |
Vendor Page | Anti SDS pAb (ATL-HPA039230) |