Anti S100P pAb (ATL-HPA019502 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019502-25

Protein Description: S100 calcium binding protein P
Gene Name: S100P
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044080: 54%, ENSRNOG00000012410: 55%
Entrez Gene ID: 6286
Uniprot ID: P25815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEF
• Gene Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEF
• Gene ID - Mouse: ENSMUSG00000044080
• Gene ID - Rat: ENSRNOG00000012410
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti S100P pAb (ATL-HPA019502 w/enhanced validation) – 2 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Iwasa, Yuhei; Iwata, Keisuke; Okuno, Mitsuru; Sugiyama, Akihiko; Nishigaki, Yoichi; Ohashi, Yosuke; Tanaka, Takuji; Iwashita, Takuji; Shimizu, Masahito; Tomita, Eiichi. A Case of Early-Stage Gallbladder Cancer, Positive for ALDH1A1, Which Arose from Adenomyomatosis of the Gallbladder. Diagnostics (Basel, Switzerland). 2022;12(11)