Anti RPGRIP1L pAb (ATL-HPA039405)

Atlas Antibodies

Catalog No.: ATL-HPA039405-25

Protein Description: RPGRIP1-like
Gene Name: RPGRIP1L
Alternative Gene Name: CORS3, FTM, JBTS7, KIAA1005, MKS5, NPHP8, PPP1R134
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033282: 85%, ENSRNOG00000011829: 87%
Entrez Gene ID: 23322
Uniprot ID: Q68CZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNL
• Gene Sequence: KNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNL
• Gene ID - Mouse: ENSMUSG00000033282
• Gene ID - Rat: ENSRNOG00000011829
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPGRIP1L pAb (ATL-HPA039405) – 5 Found

Zhang, Qihong; Giacalone, Joseph C; Searby, Charles; Stone, Edwin M; Tucker, Budd A; Sheffield, Val C. Disruption of RPGR protein interaction network is the common feature of RPGR missense variations that cause XLRP. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2019;116(4):1353-1360. 

Wang, Won-Jing; Tay, Hwee Goon; Soni, Rajesh; Perumal, Geoffrey S; Goll, Mary G; Macaluso, Frank P; Asara, John M; Amack, Jeffrey D; Tsou, Meng-Fu Bryan. CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base. Nature Cell Biology. 2013;15(6):591-601. 

Yang, T Tony; Su, Jimmy; Wang, Won-Jing; Craige, Branch; Witman, George B; Tsou, Meng-Fu Bryan; Liao, Jung-Chi. Superresolution Pattern Recognition Reveals the Architectural Map of the Ciliary Transition Zone. Scientific Reports. 2015;5( 26365165):14096. 

Guo, Jiani; Yang, Yu; Ji, Zhuqing; Yao, Mengchu; Xia, Xiaotian; Sha, Xiaofeng; Huang, Mingde. Case Report: Novel RPGRIP1L Gene Mutations Identified by Whole Exome Sequencing in a Patient With Multiple Primary Tumors. Frontiers In Genetics. 12( 33597970):620472. 

Shen, Xiao-Lin; Yuan, Jin-Feng; Qin, Xuan-He; Song, Guang-Ping; Hu, Huai-Bin; Tu, Hai-Qing; Song, Zeng-Qing; Li, Pei-Yao; Xu, Yu-Ling; Li, Sen; Jian, Xiao-Xiao; Li, Jia-Ning; He, Chun-Yu; Yu, Xi-Ping; Liang, Li-Yun; Wu, Min; Han, Qiu-Ying; Wang, Kai; Li, Ai-Ling; Zhou, Tao; Zhang, Yu-Cheng; Wang, Na; Li, Hui-Yan. LUBAC regulates ciliogenesis by promoting CP110 removal from the mother centriole. The Journal Of Cell Biology. 2022;221(1)