Anti RANBP3L pAb (ATL-HPA037471)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037471-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: RANBP3L
Alternative Gene Name: FLJ25422
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110746: 69%, ENSRNOG00000026857: 29%
Entrez Gene ID: 202151
Uniprot ID: Q86VV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTTIPRKGSSHLPGSLHTCKLKLQEDRRQQEKSVIAQPIFVFEKGEQTFKRPAEDTLYEAAEPECNGFPRKRVRSSSFTFH |
Gene Sequence | MTTIPRKGSSHLPGSLHTCKLKLQEDRRQQEKSVIAQPIFVFEKGEQTFKRPAEDTLYEAAEPECNGFPRKRVRSSSFTFH |
Gene ID - Mouse | ENSMUSG00000110746 |
Gene ID - Rat | ENSRNOG00000026857 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RANBP3L pAb (ATL-HPA037471) | |
Datasheet | Anti RANBP3L pAb (ATL-HPA037471) Datasheet (External Link) |
Vendor Page | Anti RANBP3L pAb (ATL-HPA037471) at Atlas Antibodies |
Documents & Links for Anti RANBP3L pAb (ATL-HPA037471) | |
Datasheet | Anti RANBP3L pAb (ATL-HPA037471) Datasheet (External Link) |
Vendor Page | Anti RANBP3L pAb (ATL-HPA037471) |