Anti RAB3GAP2 pAb (ATL-HPA026273)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026273-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RAB3GAP2
Alternative Gene Name: DKFZP434D245, KIAA0839, RAB3-GAP150, SPG69
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039318: 99%, ENSRNOG00000002353: 99%
Entrez Gene ID: 25782
Uniprot ID: Q9H2M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA |
| Gene Sequence | TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA |
| Gene ID - Mouse | ENSMUSG00000039318 |
| Gene ID - Rat | ENSRNOG00000002353 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RAB3GAP2 pAb (ATL-HPA026273) | |
| Datasheet | Anti RAB3GAP2 pAb (ATL-HPA026273) Datasheet (External Link) |
| Vendor Page | Anti RAB3GAP2 pAb (ATL-HPA026273) at Atlas Antibodies |
| Documents & Links for Anti RAB3GAP2 pAb (ATL-HPA026273) | |
| Datasheet | Anti RAB3GAP2 pAb (ATL-HPA026273) Datasheet (External Link) |
| Vendor Page | Anti RAB3GAP2 pAb (ATL-HPA026273) |
| Citations for Anti RAB3GAP2 pAb (ATL-HPA026273) – 1 Found |
| Xu, Dijin; Li, Yuqi; Wu, Lizhen; Li, Ying; Zhao, Dongyu; Yu, Jinhai; Huang, Tuozhi; Ferguson, Charles; Parton, Robert G; Yang, Hongyuan; Li, Peng. Rab18 promotes lipid droplet (LD) growth by tethering the ER to LDs through SNARE and NRZ interactions. The Journal Of Cell Biology. 2018;217(3):975-995. PubMed |