Anti PRUNE1 pAb (ATL-HPA028411)

Atlas Antibodies

Catalog No.: ATL-HPA028411-25

Protein Description: prune exopolyphosphatase
Gene Name: PRUNE1
Alternative Gene Name: DRES-17, H-PRUNE, HTCD37, PRUNE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015711: 76%, ENSRNOG00000021120: 71%
Entrez Gene ID: 58497
Uniprot ID: Q86TP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQ
• Gene Sequence: LERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQ
• Gene ID - Mouse: ENSMUSG00000015711
• Gene ID - Rat: ENSRNOG00000021120
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.